Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G09590 149 / 1e-45 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT1G01310 142 / 2e-42 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G31470 134 / 8e-40 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT5G02730 129 / 1e-37 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G25780 126 / 8e-37 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G30320 125 / 1e-36 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT5G57625 125 / 6e-36 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT3G19690 121 / 4e-35 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G25790 122 / 6e-35 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G33720 116 / 3e-33 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025279 [exp] 331 / 2e-117 AT3G09590 144 / 7e-44 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10003990 [exp] 224 / 3e-73 AT1G01310 140 / 3e-40 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10001319 [exp] 147 / 5e-45 AT4G30320 201 / 6e-67 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10006980 [exp] 144 / 5e-44 AT4G30320 203 / 1e-67 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10013693 [exp] 141 / 1e-42 AT4G31470 196 / 1e-64 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10005557 [exp] 140 / 3e-42 AT4G31470 199 / 2e-65 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10019993 [exp] 137 / 7e-41 AT4G30320 197 / 7e-65 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10015522 [exp] 132 / 3e-39 AT4G30320 199 / 7e-66 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10011318 [exp] 129 / 6e-38 AT4G31470 164 / 1e-51 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G082000 [exp] 162 / 2e-50 AT3G09590 137 / 2e-40 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.006G215600 [exp] 161 / 5e-50 AT3G09590 132 / 1e-38 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.018G096007 [exp] 138 / 1e-41 AT4G30320 215 / 1e-72 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.006G171300 [exp] 137 / 4e-41 AT4G30320 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.018G007000 [exp] 127 / 2e-37 AT4G31470 185 / 6e-60 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G083300 [exp] 122 / 2e-35 AT2G14610 203 / 9e-68 pathogenesis-related gene 1 (.1) Potri.009G083100 [exp] 121 / 5e-35 AT2G14610 201 / 4e-67 pathogenesis-related gene 1 (.1) Potri.009G083000 [exp] 120 / 6e-35 AT4G33720 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.018G096028 [exp] 116 / 2e-32 AT4G25780 219 / 3e-72 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.001G288600 [exp] 111 / 4e-31 AT2G14610 214 / 6e-72 pathogenesis-related gene 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0659 [flax] [poplar] CAP PF00188 [flax] [poplar] CAP Cysteine-rich secretory protein family
Representative CDS sequence Show only first row Show all	>Lus10009068 pacid=23172427 polypeptide=Lus10009068 locus=Lus10009068.g ID=Lus10009068.BGIv1.0 annot-version=v1.0 ATGTCGTCCGCCGCCGATCAAATCACGTCAATTCCTCCAATCTTTCTCCTCCTCCTCCTCCTCATTGTCGCCGTCCCCGACTGCTCCTGTCTAACACTGT CTGTGGATGGGCCAAACCGCTCGACGTCGGTAACCGCATTATCCTCACAATTCCTGTCGGCCCACAATAAGGTACGGTCCAGGTACTACCTGCCGGCCCT GAAATGGAACCGGGACCTGGCCCGGTTCGCCAGGCACTACGCCTACACGCGCCAGAACGACTGCCAGCTGATCCACTCGAACAATCGGGTGTACGGGGAG AACCTGTTCTGGAGCAAGAACGGGCACTGGACGCCGGAGAACGTGGTGAAGAAGTGGGCGGAGGAGAACAAGTACTACGATTTCGGGAGCAACCGGTGCT TGAACAATCAGCCATGCGGGCATTTCACGCAGGTGATTTGGAAGTCGACCACCGAGCTGGGCTGCGGCAAGGTCGAGTGTTATGGCGGGAAGGGGTTCTT GTTTGTATGTGCTTACAACCCGCCTGGAAATTACTATTTCGAAGGCCCATTGGGCGGCCTGTTTAAGAACTCCATTGTCTAA
AA sequence Show only first row Show all	>Lus10009068 pacid=23172427 polypeptide=Lus10009068 locus=Lus10009068.g ID=Lus10009068.BGIv1.0 annot-version=v1.0 MSSAADQITSIPPIFLLLLLLIVAVPDCSCLTLSVDGPNRSTSVTALSSQFLSAHNKVRSRYYLPALKWNRDLARFARHYAYTRQNDCQLIHSNNRVYGE NLFWSKNGHWTPENVVKKWAEENKYYDFGSNRCLNNQPCGHFTQVIWKSTTELGCGKVECYGGKGFLFVCAYNPPGNYYFEGPLGGLFKNSIV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G09590			CAP (Cysteine-rich secretory p...		Lus10009068 [exp]	0	1
AT3G62930			Thioredoxin superfamily protei...		Lus10005940 [exp]	3.5	0.8250
AT4G28570			Long-chain fatty alcohol dehyd...		Lus10021165 [exp]	9.7	0.7944
					Lus10021242 [exp]	10.5	0.7798
AT5G04770		CAT6, ATCAT6	ARABIDOPSIS THALIANA CATIONIC ...		Lus10040142 [exp]	13.0	0.7356
AT3G26000			Ribonuclease inhibitor (.1)		Lus10011378 [exp]	16.4	0.7110
AT5G40780		LHT1, LTH1	lysine histidine transporter 1...		Lus10014606 [exp]	16.9	0.7625
AT5G40780		LHT1, LTH1	lysine histidine transporter 1...		Lus10032073 [exp]	17.7	0.7524
					Lus10002735 [exp]	18.8	0.7077
AT4G36945			PLC-like phosphodiesterases su...		Lus10019339 [exp]	19.4	0.7465
AT5G40780		LHT1, LTH1	lysine histidine transporter 1...		Lus10032074 [exp]	21.2	0.7533

Compare expression of checked genes

Lus10009068 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.