Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G58090 97 / 2e-25 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025274 [exp] 190 / 2e-63 AT3G58090 115 / 5e-32 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G216000 [exp] 98 / 4e-27 AT3G58090 131 / 4e-38 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.004G189600 [exp] 38 / 0.0007 AT5G22760 879 / 0.0 PHD finger family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10009074 pacid=23172428 polypeptide=Lus10009074 locus=Lus10009074.g ID=Lus10009074.BGIv1.0 annot-version=v1.0 ATGGATAGCAAAGGCAAAGAAATTGAAATTGAAGAATCTTCACCAGTCTCCGTCTTCAAGCTACCAGGAGAGCCAGCTGTCGTCATCAATGGCGTCCCTG ATATCGTCCTCCTAAAGAACGAAGGCCTATCTCAGCCGAGAGTTGCGGAACGTGCAGAATCATCGCAAGGAGAAGAAATTGTCGGGACTGAAGGTTTCGG CGAATGGTTGGAAGGGAGGCAAGTTAAGAAGTCGTTCGATGATAAGTATTTCTCCGGTACTGTGACGCGGTACGACAAGGAAACAAAATGGTACAGGGTG GAGTACGAAGATGGCGATTTCTTAAAATATCATGCAATTCGTTTATACTAG
AA sequence Show only first row Show all	>Lus10009074 pacid=23172428 polypeptide=Lus10009074 locus=Lus10009074.g ID=Lus10009074.BGIv1.0 annot-version=v1.0 MDSKGKEIEIEESSPVSVFKLPGEPAVVINGVPDIVLLKNEGLSQPRVAERAESSQGEEIVGTEGFGEWLEGRQVKKSFDDKYFSGTVTRYDKETKWYRV EYEDGDFLKYHAIRLY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G58090			Disease resistance-responsive ...		Lus10009074 [exp]	0	1
AT1G34370	C2H2ZnF	STOP1	sensitive to proton rhizotoxic...		Lus10011495 [exp]	2.6	0.8545
AT3G23610		DSPTP1	dual specificity protein phosp...		Lus10021940 [exp]	3.2	0.8382
AT5G52880			F-box family protein (.1)		Lus10027547 [exp]	4.9	0.8048
AT1G76890	Trihelix	AT-GT2, GT2	Duplicated homeodomain-like su...		Lus10020873 [exp]	5.5	0.8198
AT5G38900			Thioredoxin superfamily protei...		Lus10034369 [exp]	6.5	0.8284
AT1G55805			BolA-like family protein (.1)		Lus10002318 [exp]	8.4	0.8135
AT5G04000			unknown protein		Lus10018038 [exp]	8.8	0.8095
AT5G52980			unknown protein		Lus10000151 [exp]	11.0	0.7573
AT1G70480			Domain of unknown function (DU...		Lus10029147 [exp]	11.6	0.8107
AT3G13845			unknown protein		Lus10015617 [exp]	11.7	0.7942

Compare expression of checked genes

Lus10009074 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.