Lus10009090 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G05340 179 / 2e-55 Peroxidase superfamily protein (.1)
AT5G06730 167 / 2e-50 Peroxidase superfamily protein (.1)
AT5G06720 166 / 2e-50 ATPA2 peroxidase 2 (.1)
AT4G11290 164 / 1e-49 Peroxidase superfamily protein (.1)
AT5G58390 162 / 3e-49 Peroxidase superfamily protein (.1)
AT4G16270 161 / 4e-48 Peroxidase superfamily protein (.1)
AT5G15180 159 / 8e-48 Peroxidase superfamily protein (.1)
AT2G18150 159 / 1e-47 Peroxidase superfamily protein (.1)
AT1G68850 159 / 2e-47 Peroxidase superfamily protein (.1)
AT5G58400 158 / 3e-47 Peroxidase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025256 322 / 2e-111 AT5G05340 290 / 4e-97 Peroxidase superfamily protein (.1)
Lus10009937 195 / 9e-62 AT5G05340 347 / 6e-120 Peroxidase superfamily protein (.1)
Lus10025255 184 / 1e-57 AT5G05340 337 / 2e-115 Peroxidase superfamily protein (.1)
Lus10024209 176 / 4e-54 AT1G14550 432 / 3e-153 Peroxidase superfamily protein (.1)
Lus10034207 175 / 6e-54 AT5G05340 454 / 8e-162 Peroxidase superfamily protein (.1)
Lus10009936 174 / 1e-53 AT5G05340 361 / 5e-125 Peroxidase superfamily protein (.1)
Lus10008581 173 / 3e-53 AT5G05340 367 / 6e-128 Peroxidase superfamily protein (.1)
Lus10000346 173 / 2e-52 AT5G05340 394 / 8e-137 Peroxidase superfamily protein (.1)
Lus10029065 172 / 2e-52 AT5G05340 338 / 2e-115 Peroxidase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G154400 206 / 2e-66 AT5G05340 363 / 3e-126 Peroxidase superfamily protein (.1)
Potri.016G132700 189 / 1e-59 AT5G05340 367 / 2e-127 Peroxidase superfamily protein (.1)
Potri.013G083600 178 / 4e-55 AT5G05340 483 / 2e-173 Peroxidase superfamily protein (.1)
Potri.006G107000 176 / 2e-54 AT5G05340 349 / 2e-120 Peroxidase superfamily protein (.1)
Potri.001G458900 176 / 2e-54 AT1G14540 389 / 3e-136 Peroxidase superfamily protein (.1)
Potri.001G458700 175 / 5e-54 AT1G14540 394 / 4e-138 Peroxidase superfamily protein (.1)
Potri.010G236870 175 / 6e-54 AT1G14550 409 / 3e-144 Peroxidase superfamily protein (.1)
Potri.010G236900 175 / 6e-54 AT1G14550 407 / 2e-143 Peroxidase superfamily protein (.1)
Potri.010G236890 173 / 2e-53 AT1G14550 417 / 3e-147 Peroxidase superfamily protein (.1)
Potri.016G058200 172 / 1e-52 AT5G06720 428 / 2e-151 peroxidase 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Lus10009090 pacid=23172420 polypeptide=Lus10009090 locus=Lus10009090.g ID=Lus10009090.BGIv1.0 annot-version=v1.0
ATGGCTCCTCCAAGTCTTATTAACCACAGTTTTACCACACTACTTCTCCTGACTAGTTTCCTTGCCGTAGGGACCTCGATCTCTTTGGTGCTCGGCTTAT
CTCTCAATTCCTACGATCAGACGTGCCCTCTCGCCACCTCCAAGATCAAAGAGATCGTCAACCAAGCAGTCCAGACTGAGAGGCGCATGGGTGCCTCTCT
CATTCGTCTTCACTTCCACGATTGCTTGTCAATATGTCATGGATTGGTACTGCTAGACGAAGTGGCACCAAGTTTGGTAGGAGAGAAGACTGCGGCGCCA
AACGACAACTCCTTGAGAGGGTTCGATGTGATAGACAACATCAAAGCGGCGTTGGAAAGTATGTGTCCAGGAGTTGTGTCCTGTTCTGATATCTTGACGG
TGGCGGCCCGCGATGCCGTTGTTGCTCTTGGAGGGCCAAGTTGGCAAGTTCTACTTGGAAGAAAAGACTCCACCAACGCGAATTTCTCCAGCGCACTCGA
AAACCTCCCTTCTCCGTTTATAGATTCCAACGACCTCGCCGCTGCCTTTGCCCTCAAGGGCTTTACATCCCAGGAAATGGTCACTCTCTCTGGTACTCTA
GAGATAGGTGGTCTTGTTATGAAGCAATGA
AA sequence
>Lus10009090 pacid=23172420 polypeptide=Lus10009090 locus=Lus10009090.g ID=Lus10009090.BGIv1.0 annot-version=v1.0
MAPPSLINHSFTTLLLLTSFLAVGTSISLVLGLSLNSYDQTCPLATSKIKEIVNQAVQTERRMGASLIRLHFHDCLSICHGLVLLDEVAPSLVGEKTAAP
NDNSLRGFDVIDNIKAALESMCPGVVSCSDILTVAARDAVVALGGPSWQVLLGRKDSTNANFSSALENLPSPFIDSNDLAAAFALKGFTSQEMVTLSGTL
EIGGLVMKQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G05340 Peroxidase superfamily protein... Lus10009090 0 1
AT5G67360 ARA12 Subtilase family protein (.1) Lus10027891 4.9 1.0000
Lus10002313 6.9 1.0000
Lus10026042 8.5 1.0000
Lus10024762 11.0 1.0000
Lus10006296 11.1 1.0000
Lus10012669 14.7 1.0000
AT5G45890 SAG12 senescence-associated gene 12 ... Lus10020731 15.9 1.0000
Lus10013504 15.9 1.0000
Lus10032814 18.0 1.0000
AT2G36190 ATCWINV4 cell wall invertase 4 (.1) Lus10014217 18.8 1.0000

Lus10009090 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.