Lus10009091 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G58390 130 / 5e-38 Peroxidase superfamily protein (.1)
AT5G05340 122 / 1e-34 Peroxidase superfamily protein (.1)
AT5G58400 120 / 1e-33 Peroxidase superfamily protein (.1)
AT1G14550 117 / 9e-33 Peroxidase superfamily protein (.1)
AT1G14540 114 / 1e-31 Peroxidase superfamily protein (.1)
AT4G36430 108 / 3e-29 Peroxidase superfamily protein (.1)
AT5G06720 104 / 1e-27 ATPA2 peroxidase 2 (.1)
AT2G18150 102 / 5e-27 Peroxidase superfamily protein (.1)
AT2G18140 102 / 6e-27 Peroxidase superfamily protein (.1)
AT5G66390 99 / 1e-25 Peroxidase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025255 232 / 2e-77 AT5G05340 337 / 2e-115 Peroxidase superfamily protein (.1)
Lus10006534 136 / 8e-40 AT5G05340 399 / 3e-140 Peroxidase superfamily protein (.1)
Lus10000625 130 / 1e-39 AT5G05340 172 / 5e-54 Peroxidase superfamily protein (.1)
Lus10009935 132 / 2e-38 AT5G05340 358 / 9e-124 Peroxidase superfamily protein (.1)
Lus10034207 132 / 2e-38 AT5G05340 454 / 8e-162 Peroxidase superfamily protein (.1)
Lus10009933 125 / 1e-35 AT5G05340 364 / 2e-126 Peroxidase superfamily protein (.1)
Lus10024207 123 / 3e-35 AT1G14550 322 / 2e-110 Peroxidase superfamily protein (.1)
Lus10030148 123 / 3e-35 AT5G05340 410 / 3e-145 Peroxidase superfamily protein (.1)
Lus10000346 124 / 1e-34 AT5G05340 394 / 8e-137 Peroxidase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G132900 163 / 2e-50 AT5G05340 350 / 6e-121 Peroxidase superfamily protein (.1)
Potri.006G107000 161 / 8e-50 AT5G05340 349 / 2e-120 Peroxidase superfamily protein (.1)
Potri.016G132800 160 / 1e-49 AT5G05340 336 / 3e-115 Peroxidase superfamily protein (.1)
Potri.014G143200 142 / 2e-42 AT5G05340 404 / 5e-142 Peroxidase superfamily protein (.1)
Potri.013G083600 142 / 3e-42 AT5G05340 483 / 2e-173 Peroxidase superfamily protein (.1)
Potri.013G154400 138 / 7e-41 AT5G05340 363 / 3e-126 Peroxidase superfamily protein (.1)
Potri.013G156500 127 / 1e-36 AT5G05340 441 / 1e-156 Peroxidase superfamily protein (.1)
Potri.010G236850 125 / 7e-36 AT1G14550 404 / 5e-142 Peroxidase superfamily protein (.1)
Potri.010G236910 125 / 7e-36 AT1G14550 404 / 5e-142 Peroxidase superfamily protein (.1)
Potri.010G236870 124 / 1e-35 AT1G14550 409 / 3e-144 Peroxidase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Lus10009091 pacid=23172415 polypeptide=Lus10009091 locus=Lus10009091.g ID=Lus10009091.BGIv1.0 annot-version=v1.0
ATGCAAGGCCTCAACGAAAGGGACCTTGTAGCAATCGGGTTCGCGCAGTGCTGGTTCTTCAGGAACCGAATCTTCAACGAGACATCCGCCAGCAACATCA
ACCCTAAGTTGGCCAGCGAGCGCCGTTCAAACTGTTTCGCCAACTCCGGAGACACCAACCTCTCTTCCTTGAACAGCTCAGCAGCCAGCTTCGACATTTC
GTACTTCAAGAACTTGGTCGCCAAGAAAGGGTTGCTTCACTCCGACCAAGCCCTCTTCGCTGGCGGGTCCACCGACTCCCTGGTCAGCACTTACAGCTCG
AACGAAAGGAGTTTCTGGTACGATTTCGCCAACTCAATGGTTAAGATGGGGAACATTAAGCCGTTGACTGGGAACCGTGGTCAGATTCGAGCCAACTGCA
GGAGGGTCAACTAA
AA sequence
>Lus10009091 pacid=23172415 polypeptide=Lus10009091 locus=Lus10009091.g ID=Lus10009091.BGIv1.0 annot-version=v1.0
MQGLNERDLVAIGFAQCWFFRNRIFNETSASNINPKLASERRSNCFANSGDTNLSSLNSSAASFDISYFKNLVAKKGLLHSDQALFAGGSTDSLVSTYSS
NERSFWYDFANSMVKMGNIKPLTGNRGQIRANCRRVN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G05340 Peroxidase superfamily protein... Lus10009091 0 1
AT5G53910 RING/U-box superfamily protein... Lus10011380 7.6 0.6570
Lus10013260 10.8 0.6570
Lus10005297 13.2 0.6570
AT3G52490 Double Clp-N motif-containing ... Lus10024536 15.2 0.6570
AT2G06090 Plant self-incompatibility pro... Lus10011896 17.0 0.6570
Lus10006529 18.7 0.6570
AT5G33340 CDR1 CONSTITUTIVE DISEASE RESISTANC... Lus10039858 19.2 0.6535
Lus10035557 20.1 0.6570
AT4G22880 TT18, TDS4, ANS... TANNIN DEFICIENT SEED 4, ANTHO... Lus10006709 21.1 0.6424
AT3G13790 ATCWINV1, ATBFR... ARABIDOPSIS THALIANA CELL WALL... Lus10015614 21.5 0.6570

Lus10009091 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.