Gene [FLAX] | FIBexDB

Lus10009101 [FLAX]

External link

JGI Phytozome v13

[genome browser]

Symbol

Arabidopsis homologues

Show only best Show top 10

No hit found

Paralogs

Show only best Show top 10

Gene ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Lus10027494 [exp]	83 / 3e-22	ND	34 / 0.006
Lus10005297 [exp]	56 / 1e-11	ND	40 / 5e-05
Lus10031374 [exp]	55 / 6e-10	AT1G07650	1221 / 0.0	Leucine-rich repeat transmembrane protein kinase (.1.2)
Lus10011601 [exp]	49 / 8e-09	AT2G13980	46 / 3e-07	Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10011742 [exp]	46 / 6e-07	AT3G24200	653 / 0.0	FAD/NAD(P)-binding oxidoreductase family protein (.1), FAD/NAD(P)-binding oxidoreductase family protein (.2)
Lus10037909 [exp]	45 / 1e-06	ND	38 / 0.002
Lus10000805 [exp]	44 / 1e-06	AT1G27220	40 / 7e-05	paired amphipathic helix repeat-containing protein (.1)
Lus10043127 [exp]	43 / 8e-06	AT5G46740	362 / 2e-115	ubiquitin-specific protease 21 (.1)
Lus10004409 [exp]	42 / 8e-06	ND	39 / 5e-04

Poplar homologues

Show only best Show top 10

No hit found

PFAM info

Representative CDS sequence

Show only first row Show all

>Lus10009101 pacid=23172410 polypeptide=Lus10009101 locus=Lus10009101.g ID=Lus10009101.BGIv1.0 annot-version=v1.0

ATGGGATTCAAACAATGGCTTGTTGCAGGGATGTCGGAACCTAAGGAGGGGGAAGCTCGAGCACTATTGGAAGGCATTCGATGGTTACAAGAGATGGATC

ACACGCATGTCATGGTGGAAACTGATTGCTTATCGGTGCTCTCGACGCTTAATGATGAAATTGAAGATGTTACGGAATTTAGGGACATCAATAGTGAGTG

CAAGGAGATACTTTCAATTGAACCAGATTTTTCAGTTGTGTTTGTAACGAGAGATGGTAATGGTGTCACTCACACATTAACTAGGTGA

AA sequence

Show only first row Show all

>Lus10009101 pacid=23172410 polypeptide=Lus10009101 locus=Lus10009101.g ID=Lus10009101.BGIv1.0 annot-version=v1.0

MGFKQWLVAGMSEPKEGEARALLEGIRWLQEMDHTHVMVETDCLSVLSTLNDEIEDVTEFRDINSECKEILSIEPDFSVVFVTRDGNGVTHTLTR

DESeq2's median of ratios [FLAX]

Coexpressed genes

Download tab-delimited text

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10009101 [exp]	0	1

Lus10009101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.