Lus10009108 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G57670 104 / 2e-26 Toll-Interleukin-Resistance (TIR) domain family protein (.1)
AT5G36930 101 / 7e-25 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
AT3G44480 101 / 1e-24 COG1, RPP10, RPP1 recognition of peronospora parasitica 1, Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT3G44630 100 / 2e-24 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2), Disease resistance protein (TIR-NBS-LRR class) family (.3)
AT4G16900 100 / 2e-24 Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT4G11170 99 / 5e-24 Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT4G16950 99 / 5e-24 RPP5 RECOGNITION OF PERONOSPORA PARASITICA 5, Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
AT4G19510 98 / 2e-23 Disease resistance protein (TIR-NBS-LRR class) (.1), Disease resistance protein (TIR-NBS-LRR class) (.2)
AT2G32140 96 / 3e-23 transmembrane receptors (.1)
AT5G45060 96 / 7e-23 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004075 182 / 4e-53 AT4G12010 348 / 3e-102 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Lus10015350 179 / 1e-51 AT4G12010 422 / 2e-127 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Lus10012246 174 / 2e-50 AT4G12010 396 / 9e-122 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Lus10009107 168 / 6e-48 AT4G12010 347 / 4e-101 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Lus10042777 154 / 5e-47 AT3G44630 136 / 2e-36 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2), Disease resistance protein (TIR-NBS-LRR class) family (.3)
Lus10007030 160 / 7e-46 AT4G12010 316 / 3e-94 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Lus10015648 161 / 1e-45 AT4G12010 420 / 1e-126 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Lus10017419 157 / 5e-45 AT4G12010 272 / 9e-80 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Lus10017418 156 / 6e-44 AT5G44510 335 / 1e-96 target of AVRB operation1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G069866 114 / 1e-31 AT4G12010 179 / 4e-52 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Potri.019G069733 112 / 2e-30 AT2G20142 147 / 1e-42 Toll-Interleukin-Resistance (TIR) domain family protein (.1)
Potri.019G070700 116 / 5e-30 AT5G17680 722 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.019G095932 114 / 1e-29 AT4G11170 294 / 5e-88 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Potri.019G069600 114 / 3e-29 AT5G17680 647 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.019G098800 112 / 3e-29 AT4G16860 255 / 3e-75 recognition of peronospora parasitica 4, Disease resistance protein (TIR-NBS-LRR class) family (.1)
Potri.019G069500 114 / 5e-29 AT5G17680 711 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.019G098600 107 / 5e-29 AT2G20142 138 / 4e-40 Toll-Interleukin-Resistance (TIR) domain family protein (.1)
Potri.019G097300 112 / 7e-29 AT4G16860 272 / 8e-81 recognition of peronospora parasitica 4, Disease resistance protein (TIR-NBS-LRR class) family (.1)
Potri.019G070436 106 / 8e-29 AT2G20142 160 / 7e-49 Toll-Interleukin-Resistance (TIR) domain family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0173 STIR PF01582 TIR TIR domain
Representative CDS sequence
>Lus10009108 pacid=23150069 polypeptide=Lus10009108 locus=Lus10009108.g ID=Lus10009108.BGIv1.0 annot-version=v1.0
ATGGCTTCCGCGTCATCCTCTTCCCATTCTTCCGGGACATGGGAATACGAAGTATTTGTGTGTTTCCGGGGCGGAATGCGGGAGGGTTTTACCAAAGACG
TTGTGGACGCTTTGACCGAAAAGAATATCAAAACCTTCATGGACACCATGCTTAAGAAAACAGAGAGCATCGCAGAGCTGGTGTCGATCCTGAAAGACCC
GCCAATTTCGGTGGTGATTCTCTCCCCCGGATTCGCCGAGTCCCCGTGGTGCCTTGACGAGGTGCATGCCATAGCCAACCGCGTGGAAAATGATGGGCAC
AGGGTGTTACCGGTTTTCTACAAGGTGGATCCATCAGATGTCACGGATGACTCCGGTAGCTTCGCTGCAGCAATCGATCATCTTGAAAGACACAGCTTGG
ATCAGAAGACGACATGGAGGGTCGCACTTAAAGATGTTGCTGATCAGGCTGGCCTCTGCTTCCCGTCTGATGAATTCAGGGGGGAACATAAGTTGATCAA
AGCTATCGTTGGCAATGCGAACGAGTTGCTAGAAGAAATGGCAGAAAGCCTTGATGTATCGACAACGACTGGGTCGGAATGGATTCACGAGTTGAAGAAA
TTAAACAGTTGCCAGAGATGA
AA sequence
>Lus10009108 pacid=23150069 polypeptide=Lus10009108 locus=Lus10009108.g ID=Lus10009108.BGIv1.0 annot-version=v1.0
MASASSSSHSSGTWEYEVFVCFRGGMREGFTKDVVDALTEKNIKTFMDTMLKKTESIAELVSILKDPPISVVILSPGFAESPWCLDEVHAIANRVENDGH
RVLPVFYKVDPSDVTDDSGSFAAAIDHLERHSLDQKTTWRVALKDVADQAGLCFPSDEFRGEHKLIKAIVGNANELLEEMAESLDVSTTTGSEWIHELKK
LNSCQR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G11170 Disease resistance protein (TI... Lus10009108 0 1
AT5G05970 NEDD1 NEURAL PRECURSOR CELL EXPRESSE... Lus10040260 35.5 0.7682
Lus10013906 40.6 0.7434
AT2G30130 AS2 PCK1, LBD12, AS... PEACOCK 1, Lateral organ bound... Lus10005284 49.8 0.6974
AT2G44480 BGLU17 beta glucosidase 17 (.1.2) Lus10031234 198.9 0.7063

Lus10009108 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.