Lus10009111 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G37930 134 / 5e-38 Protein with RING/U-box and TRAF-like domains (.1)
AT5G37870 122 / 8e-34 Protein with RING/U-box and TRAF-like domains (.1)
AT1G66620 112 / 1e-29 Protein with RING/U-box and TRAF-like domains (.1)
AT5G37890 108 / 2e-28 Protein with RING/U-box and TRAF-like domains (.1)
AT5G37910 102 / 3e-26 Protein with RING/U-box and TRAF-like domains (.1)
AT1G66650 100 / 4e-25 Protein with RING/U-box and TRAF-like domains (.1)
AT5G62800 95 / 5e-23 Protein with RING/U-box and TRAF-like domains (.1)
AT1G66630 89 / 6e-21 Protein with RING/U-box and TRAF-like domains (.1)
AT5G37900 87 / 1e-20 TRAF-like superfamily protein (.1)
AT1G66610 77 / 1e-16 TRAF-like superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028535 442 / 2e-160 AT5G37930 134 / 7e-38 Protein with RING/U-box and TRAF-like domains (.1)
Lus10013739 69 / 7e-14 AT3G58040 493 / 6e-178 seven in absentia of Arabidopsis 2 (.1)
Lus10039202 69 / 1e-13 AT3G58040 488 / 1e-175 seven in absentia of Arabidopsis 2 (.1)
Lus10018110 57 / 1e-09 AT4G27880 553 / 0.0 Protein with RING/U-box and TRAF-like domains (.1)
Lus10022405 57 / 1e-09 AT4G27880 553 / 0.0 Protein with RING/U-box and TRAF-like domains (.1)
Lus10016348 57 / 2e-09 AT3G61790 459 / 7e-163 Protein with RING/U-box and TRAF-like domains (.1)
Lus10002761 57 / 2e-09 AT3G61790 462 / 1e-164 Protein with RING/U-box and TRAF-like domains (.1)
Lus10030248 57 / 2e-09 AT3G61790 514 / 0.0 Protein with RING/U-box and TRAF-like domains (.1)
Lus10004001 56 / 3e-09 AT3G61790 525 / 0.0 Protein with RING/U-box and TRAF-like domains (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G148100 248 / 3e-81 AT5G37930 206 / 4e-63 Protein with RING/U-box and TRAF-like domains (.1)
Potri.004G072800 223 / 4e-72 AT5G37930 173 / 9e-51 Protein with RING/U-box and TRAF-like domains (.1)
Potri.004G091900 211 / 3e-69 AT5G37930 143 / 3e-41 Protein with RING/U-box and TRAF-like domains (.1)
Potri.017G122800 179 / 1e-54 AT5G37930 180 / 5e-53 Protein with RING/U-box and TRAF-like domains (.1)
Potri.004G091800 134 / 2e-36 AT5G37930 81 / 4e-16 Protein with RING/U-box and TRAF-like domains (.1)
Potri.001G010500 61 / 4e-11 AT3G58040 455 / 3e-163 seven in absentia of Arabidopsis 2 (.1)
Potri.003G215400 61 / 8e-11 AT3G58040 471 / 4e-169 seven in absentia of Arabidopsis 2 (.1)
Potri.006G194100 60 / 1e-10 AT3G58040 560 / 0.0 seven in absentia of Arabidopsis 2 (.1)
Potri.016G059700 59 / 2e-10 AT3G58040 548 / 0.0 seven in absentia of Arabidopsis 2 (.1)
Potri.002G171500 59 / 5e-10 AT3G61790 558 / 0.0 Protein with RING/U-box and TRAF-like domains (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0389 TRAF PF03145 Sina Seven in absentia protein family
Representative CDS sequence
>Lus10009111 pacid=23150066 polypeptide=Lus10009111 locus=Lus10009111.g ID=Lus10009111.BGIv1.0 annot-version=v1.0
ATGGCATACAAGTGTCCTTCATGTTGCTTGCCAATTGGCTACAACCGGTGCCGCGCAATCGAAAAGGTTTTAGAATCAGCCACCGTACAATGCTCAAATG
CATCCAACGGCTGCAAAGAAATAATCACCTACAGCAAAAAACAGGCACATGACAAGGACTGCATCTATGCACCATGTCAGTGTCCTATCTCCGGCTGCAA
CTTCTCCGGCTCCGCCCAGCAGCTATGCCACCATTTCACCTCCAACCACAAGAACCGTGCGGTACAGTTCCGGTACAACACCACATTCCCAGCGTTCTTC
ACCAGCGACCACAAGTTCCTCATTCTTCAGGAGGAGAAAGAAGAGGTTCTCTTCTTTCTCACCAACAGTGAAGAAGTTATCGGGAACATGATCTACGTCA
GCTGTATAGGGCCCTCGTCGTACAAAGGGAAATTCTTCTACGAAGTGAGTGCGAAAACCGAGGACAGCAACCTTAAGTTTCAGGCCTTCACAGAGAACGT
CCTGAAGAAGGGGAATTCCCCGCCTCCAGGTGGGTTCCTTGTAGTTCCGGCTAGCTACTTTGGCAGGTACAAGCAAGTCAGTCTAGATGTCTGCATATAT
CAGGTCGAAACTTATCCTAGTGACTTTGTCCGCACCACTGCAGCTTGA
AA sequence
>Lus10009111 pacid=23150066 polypeptide=Lus10009111 locus=Lus10009111.g ID=Lus10009111.BGIv1.0 annot-version=v1.0
MAYKCPSCCLPIGYNRCRAIEKVLESATVQCSNASNGCKEIITYSKKQAHDKDCIYAPCQCPISGCNFSGSAQQLCHHFTSNHKNRAVQFRYNTTFPAFF
TSDHKFLILQEEKEEVLFFLTNSEEVIGNMIYVSCIGPSSYKGKFFYEVSAKTEDSNLKFQAFTENVLKKGNSPPPGGFLVVPASYFGRYKQVSLDVCIY
QVETYPSDFVRTTAA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G37930 Protein with RING/U-box and TR... Lus10009111 0 1
AT5G64360 EIP9 EMF1-Interacting Protein 1, Ch... Lus10015692 2.8 0.8626
AT2G30620 winged-helix DNA-binding trans... Lus10005534 3.2 0.8606
AT1G64450 Glycine-rich protein family (.... Lus10023071 4.6 0.8665
AT1G47200 WPP2 WPP domain protein 2 (.1) Lus10042643 4.6 0.8909
AT5G64360 EIP9 EMF1-Interacting Protein 1, Ch... Lus10037698 4.9 0.8499
AT3G56850 bZIP DPBF3, AREB3 ABA-responsive element binding... Lus10008927 7.3 0.8588
AT4G28100 unknown protein Lus10018524 8.8 0.8551
AT5G27690 Heavy metal transport/detoxifi... Lus10031495 11.0 0.8503
AT4G32295 unknown protein Lus10002918 20.0 0.8688
AT2G31160 OBO1, LSH3 ORGAN BOUNDARY 1, LIGHT SENSIT... Lus10024901 20.4 0.8366

Lus10009111 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.