Lus10009113 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G13700 259 / 4e-85 ATPAP23, PAP23 purple acid phosphatase 23 (.1)
AT3G07130 202 / 2e-62 ATPAP15, PAP15 purple acid phosphatase 15 (.1)
AT2G32770 151 / 6e-43 PAP13, ATPAP13 purple acid phosphatase 13 (.1.2.3)
AT2G27190 76 / 6e-16 ATPAP12 ARABIDOPSIS THALIANA PURPLE ACID PHOSPHATASE 1, purple acid phosphatase 12 (.1)
AT5G34850 73 / 6e-15 ATPAP26, PAP26 purple acid phosphatase 26 (.1)
AT2G16430 71 / 3e-14 ATPAP10, PAP10 purple acid phosphatase 10 (.1.2)
AT1G56360 65 / 4e-12 PAP6, ATPAP6 purple acid phosphatase 6 (.1)
AT3G52810 64 / 1e-11 ATPAP21, PAP21 purple acid phosphatase 21 (.1)
AT3G52820 61 / 7e-11 ATPAP22, PAP22 purple acid phosphatase 22 (.1)
AT4G36350 61 / 9e-11 ATPAP25, PAP25 ARABIDOPSIS THALIANA PURPLE ACID PHOSPHATASE 25, purple acid phosphatase 25 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028533 393 / 8e-136 AT4G13700 696 / 0.0 purple acid phosphatase 23 (.1)
Lus10011847 216 / 2e-67 AT3G07130 830 / 0.0 purple acid phosphatase 15 (.1)
Lus10022786 213 / 5e-66 AT3G07130 828 / 0.0 purple acid phosphatase 15 (.1)
Lus10016667 211 / 8e-65 AT3G07130 788 / 0.0 purple acid phosphatase 15 (.1)
Lus10007119 171 / 8e-52 AT3G07130 376 / 1e-127 purple acid phosphatase 15 (.1)
Lus10016665 171 / 2e-50 AT3G07130 672 / 0.0 purple acid phosphatase 15 (.1)
Lus10011753 85 / 6e-20 AT3G16970 90 / 1e-22 Plant self-incompatibility protein S1 family (.1)
Lus10027710 81 / 1e-17 AT5G34850 790 / 0.0 purple acid phosphatase 26 (.1)
Lus10039978 81 / 2e-17 AT5G34850 784 / 0.0 purple acid phosphatase 26 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G176000 282 / 1e-92 AT4G13700 739 / 0.0 purple acid phosphatase 23 (.1)
Potri.002G243900 205 / 4e-63 AT3G07130 805 / 0.0 purple acid phosphatase 15 (.1)
Potri.017G055900 204 / 6e-63 AT3G07130 816 / 0.0 purple acid phosphatase 15 (.1)
Potri.017G055800 192 / 3e-58 AT3G07130 677 / 0.0 purple acid phosphatase 15 (.1)
Potri.018G123700 86 / 3e-19 AT5G34850 762 / 0.0 purple acid phosphatase 26 (.1)
Potri.006G063700 81 / 1e-17 AT5G34850 798 / 0.0 purple acid phosphatase 26 (.1)
Potri.009G121200 74 / 4e-15 AT2G16430 773 / 0.0 purple acid phosphatase 10 (.1.2)
Potri.002G029300 72 / 1e-14 AT2G16430 693 / 0.0 purple acid phosphatase 10 (.1.2)
Potri.004G160100 71 / 3e-14 AT2G16430 779 / 0.0 purple acid phosphatase 10 (.1.2)
Potri.018G024800 71 / 5e-14 AT5G34850 742 / 0.0 purple acid phosphatase 26 (.1)
PFAM info
Representative CDS sequence
>Lus10009113 pacid=23150024 polypeptide=Lus10009113 locus=Lus10009113.g ID=Lus10009113.BGIv1.0 annot-version=v1.0
ATGGATTGGCGGGAAATGGCGGCCGTTTCTCTGCTTGTGATGGAGATTGTGGTCTCCCATACTTGGGCTATACCAACAACTCTTGATGGTCCCTTCCAGC
CATTCACTCGCAGCTTTGATTCTTCTTTACGCAGAGGCAGCGACGACTTGCCCATGGATCACCCCAGGCTCATCAGAAATGTCAACGGCAATTTGCCTGA
GCAGATTGCTGTTGCTGCTTCTTTTCCCCCTACTTCAATCTGGGTATCTTGGCTCACCGGTGAAGCGAAGATGGGTAGAAATGTGATTCCTCTGGATCCA
GCTTCTGTGGGTAGTGAGTTGTATCCCTTTGAGGGCCTCTTGAATTACACCTCTCCCATCATCCACCATGTTAGAATTCATGGTCTCGAACTGGGGACAA
GATATTACTACAAATGTGGGGACAGTTCCATAACAGCTATGAGCGACGAGCTAGTCTTTGAAACCATGCCATTGTCTGGTCCAGATTCATATCCTGTTCG
AGTAGCAGTGGTTAGAGACCTCGGTCTCACAACAAACTCTACATCGACTATAGACCATTTGAGGATGAATGAACCGTGGCTAATCTTAATGGTTGGAGAT
TTGACTTATGCAAATAAGTATCTCACAACCGGCGGGAAAGGAGCTTTGTGTGTTCCCTAA
AA sequence
>Lus10009113 pacid=23150024 polypeptide=Lus10009113 locus=Lus10009113.g ID=Lus10009113.BGIv1.0 annot-version=v1.0
MDWREMAAVSLLVMEIVVSHTWAIPTTLDGPFQPFTRSFDSSLRRGSDDLPMDHPRLIRNVNGNLPEQIAVAASFPPTSIWVSWLTGEAKMGRNVIPLDP
ASVGSELYPFEGLLNYTSPIIHHVRIHGLELGTRYYYKCGDSSITAMSDELVFETMPLSGPDSYPVRVAVVRDLGLTTNSTSTIDHLRMNEPWLILMVGD
LTYANKYLTTGGKGALCVP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G13700 ATPAP23, PAP23 purple acid phosphatase 23 (.1... Lus10009113 0 1
AT3G12620 Protein phosphatase 2C family ... Lus10040346 15.0 0.6754
AT1G27180 disease resistance protein (TI... Lus10023093 19.7 0.6628
AT1G32400 TOM2A tobamovirus multiplication 2A ... Lus10040108 31.0 0.6551
AT3G57170 N-acetylglucosaminyl transfera... Lus10003248 33.0 0.6589
AT5G06810 Mitochondrial transcription te... Lus10018548 43.3 0.6040
AT3G55590 Glucose-1-phosphate adenylyltr... Lus10014608 43.7 0.6536
AT3G43790 ZIFL2 zinc induced facilitator-like ... Lus10041286 45.2 0.6089
AT1G18060 unknown protein Lus10012667 47.9 0.6435
AT2G32760 unknown protein Lus10022575 57.4 0.6288
AT2G15230 ATLIP1 lipase 1 (.1) Lus10002809 60.9 0.6286

Lus10009113 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.