Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G17450 194 / 1e-64 HIPP21 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) AT1G71050 172 / 6e-56 HIPP20 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) AT1G22990 162 / 4e-52 HIPP22 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) AT5G66110 137 / 3e-42 HIPP27 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1) AT4G38580 135 / 5e-41 HIPP26, ATFP6 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) AT4G39700 134 / 1e-40 Heavy metal transport/detoxification superfamily protein (.1) AT4G08570 123 / 2e-36 Heavy metal transport/detoxification superfamily protein (.1) AT4G35060 122 / 4e-36 HIPP25 heavy metal associated isoprenylated plant protein 25, Heavy metal transport/detoxification superfamily protein (.1) AT1G06330 97 / 7e-26 Heavy metal transport/detoxification superfamily protein (.1) AT2G18196 96 / 2e-25 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028531 [exp] 284 / 4e-100 AT5G17450 207 / 1e-69 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Lus10016708 [exp] 185 / 5e-61 AT1G71050 192 / 1e-63 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10036004 [exp] 185 / 6e-61 AT1G22990 187 / 4e-62 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Lus10042946 [exp] 184 / 1e-60 AT1G71050 196 / 3e-65 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10032446 [exp] 174 / 3e-56 AT1G71050 175 / 2e-56 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10019676 [exp] 158 / 4e-50 AT4G39700 211 / 3e-71 Heavy metal transport/detoxification superfamily protein (.1) Lus10016436 [exp] 158 / 5e-50 AT4G39700 209 / 1e-70 Heavy metal transport/detoxification superfamily protein (.1) Lus10022508 [exp] 157 / 1e-49 AT4G39700 201 / 2e-67 Heavy metal transport/detoxification superfamily protein (.1) Lus10028426 [exp] 144 / 1e-44 AT4G38580 228 / 4e-78 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G123400 [exp] 239 / 1e-82 AT5G17450 220 / 4e-75 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Potri.010G114600 [exp] 200 / 5e-67 AT1G22990 194 / 9e-65 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Potri.007G087300 [exp] 157 / 9e-50 AT4G39700 215 / 9e-73 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G079800 [exp] 155 / 5e-49 AT4G39700 189 / 2e-62 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G110400 [exp] 152 / 1e-47 AT5G66110 189 / 2e-62 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1) Potri.004G175400 [exp] 148 / 3e-46 AT4G38580 254 / 2e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.009G135300 [exp] 142 / 3e-44 AT4G38580 234 / 3e-80 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.005G167000 [exp] 138 / 2e-42 AT4G08570 229 / 1e-78 Heavy metal transport/detoxification superfamily protein (.1) Potri.002G092200 [exp] 135 / 4e-41 AT4G08570 193 / 3e-64 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G003700 [exp] 129 / 1e-38 AT4G08570 207 / 5e-70 Heavy metal transport/detoxification superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [flax] [poplar] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Lus10009115 pacid=23150038 polypeptide=Lus10009115 locus=Lus10009115.g ID=Lus10009115.BGIv1.0 annot-version=v1.0 ATGGGAGCTCTTGATCTCATATCAAACTTTTGCAGCGAGACCAGCACCGCCACAAGCACTCGAAGATCCAAGCGCAAACCAATGCAGACGGTGGAGATAA AGGTGAAAATGGACTGCGACGGGTGCGAAAGGAGAGTGAAAAATGCTGTTTCCACCATGAAAGGAGTGAAGACGGTGGAAGTAATAAGGAAACAGAACAG GGTGGTGGTGAGCGGGTACGTGGAGCCCAACCGGGTGCTGAAGCGGGTCAAGAGCACCGGGAAGGTGGCCGAGTTCTGGCCGTACGTACCGCAGCATCTC GCCTACTATCCTTACGCCGCTGGAGTTTACGACAAGAAGGCTCCCGCCGGCTTTGTCCGGAACGTCGTCCAGGCTTTCCCTAGCAACGCTAGTAACAACA ACAGTCATGTCCCGGAAGAGAATTTTGTCTCCTTCTTTAGCGACGACAACGTCAATGCTTGTTCCATCATGTGA
AA sequence Show only first row Show all	>Lus10009115 pacid=23150038 polypeptide=Lus10009115 locus=Lus10009115.g ID=Lus10009115.BGIv1.0 annot-version=v1.0 MGALDLISNFCSETSTATSTRRSKRKPMQTVEIKVKMDCDGCERRVKNAVSTMKGVKTVEVIRKQNRVVVSGYVEPNRVLKRVKSTGKVAEFWPYVPQHL AYYPYAAGVYDKKAPAGFVRNVVQAFPSNASNNNSHVPEENFVSFFSDDNVNACSIM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G17450		HIPP21	heavy metal associated isopren...		Lus10009115 [exp]	0	1
AT3G14240			Subtilase family protein (.1)		Lus10024814 [exp]	5.0	0.8485
AT1G68290		ENDO2 ,ENDO 2	endonuclease 2 (.1)		Lus10034336 [exp]	20.2	0.8464
AT1G11050			Protein kinase superfamily pro...		Lus10018860 [exp]	25.3	0.8041
AT1G13245		RTFL17, DVL4	DEVIL 4, ROTUNDIFOLIA like 17 ...		Lus10041491 [exp]	32.4	0.8441
AT5G02640			unknown protein		Lus10023327 [exp]	50.9	0.8094
AT5G27950			P-loop containing nucleoside t...		Lus10018999 [exp]	55.0	0.7938
AT2G16530			3-oxo-5-alpha-steroid 4-dehydr...		Lus10042055 [exp]	65.7	0.8225
AT5G01790			unknown protein		Lus10029060 [exp]	67.0	0.8097
AT5G53980	HD	ATHB52	homeobox protein 52 (.1)		Lus10003492 [exp]	71.2	0.7951
AT2G42760			unknown protein		Lus10005429 [exp]	73.3	0.8036

Compare expression of checked genes

Lus10009115 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.