Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G03341 94 / 3e-27 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028523 [exp] 117 / 2e-36 AT3G03341 115 / 7e-36 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G128600 [exp] 94 / 3e-27 AT3G03341 113 / 9e-35 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10009121 pacid=23150009 polypeptide=Lus10009121 locus=Lus10009121.g ID=Lus10009121.BGIv1.0 annot-version=v1.0 ATGGTGGGAGTCGGCGTACCGATTTGTATGCAATGTGGGACCCATAGCAACCCATGCCGTTGCAAGGTGGTGGGGCCGACGGTTGGGTTTCTGGCGTTCG CGGCGGCGGCAGTGGTTGAGTGGCCGGTGGGGGCGTTCGTGTACATCTTCAAGCACCGGAAAGGTAGGCGGATCATGGCCCATCCGGCCACCCAAAATTG TTATGTAATGGCGGTGTGTTGCTTTCTGTTTGAATAA
AA sequence Show only first row Show all	>Lus10009121 pacid=23150009 polypeptide=Lus10009121 locus=Lus10009121.g ID=Lus10009121.BGIv1.0 annot-version=v1.0 MVGVGVPICMQCGTHSNPCRCKVVGPTVGFLAFAAAAVVEWPVGAFVYIFKHRKGRRIMAHPATQNCYVMAVCCFLFE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G03341			unknown protein		Lus10009121 [exp]	0	1
AT2G18540			RmlC-like cupins superfamily p...		Lus10037937 [exp]	1.7	0.6920
					Lus10019699 [exp]	5.8	0.6640
AT3G47110			Leucine-rich repeat protein ki...		Lus10030854 [exp]	6.3	0.6189
AT4G01950		ATGPAT3, GPAT3	glycerol-3-phosphate acyltrans...		Lus10029839 [exp]	20.1	0.6185
AT1G06520		ATGPAT1, GPAT1	glycerol-3-phosphate acyltrans...		Lus10000072 [exp]	28.8	0.6127
					Lus10013609 [exp]	29.3	0.6125
AT2G44810		DAD1	DEFECTIVE ANTHER DEHISCENCE 1,...		Lus10028210 [exp]	30.0	0.5850
					Lus10037542 [exp]	35.7	0.5066
AT1G06520		ATGPAT1, GPAT1	glycerol-3-phosphate acyltrans...		Lus10000071 [exp]	51.8	0.5508
AT2G22180			hydroxyproline-rich glycoprote...		Lus10016800 [exp]	56.3	0.5723

Compare expression of checked genes

Lus10009121 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.