Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G03430 131 / 7e-42 Calcium-binding EF-hand family protein (.1) AT5G17480 125 / 2e-39 APC1 pollen calcium-binding protein 1 (.1) AT1G73630 66 / 6e-15 EF hand calcium-binding protein family (.1) AT1G24620 66 / 8e-15 EF hand calcium-binding protein family (.1) AT3G51920 62 / 2e-13 CML9, CAM9, ATCML9 CALMODULIN LIKE PROTEIN 9, calmodulin 9 (.1) AT1G18210 61 / 6e-13 Calcium-binding EF-hand family protein (.1.2) AT3G07490 60 / 8e-13 AtCML3, AGD11 calmodulin-like 3, ARF-GAP domain 11 (.1) AT5G37770 57 / 1e-11 CML24, TCH2 TOUCH 2, CALMODULIN-LIKE 24, EF hand calcium-binding protein family (.1) AT1G66400 55 / 6e-11 CML23 calmodulin like 23 (.1) AT2G15680 54 / 3e-10 AtCML30 calmodulin-like 30, Calcium-binding EF-hand family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028519 [exp] 170 / 3e-57 AT3G03430 132 / 2e-42 Calcium-binding EF-hand family protein (.1) Lus10033587 [exp] 160 / 2e-53 AT3G03430 131 / 8e-42 Calcium-binding EF-hand family protein (.1) Lus10031345 [exp] 67 / 4e-15 AT1G18210 196 / 1e-64 Calcium-binding EF-hand family protein (.1.2) Lus10009059 [exp] 65 / 2e-14 AT1G18210 197 / 3e-65 Calcium-binding EF-hand family protein (.1.2) Lus10018012 [exp] 64 / 5e-14 AT1G18210 195 / 2e-64 Calcium-binding EF-hand family protein (.1.2) Lus10028913 [exp] 63 / 7e-14 AT1G24620 204 / 5e-68 EF hand calcium-binding protein family (.1) Lus10004330 [exp] 63 / 8e-14 AT1G24620 207 / 2e-69 EF hand calcium-binding protein family (.1) Lus10009127 [exp] 64 / 1e-13 AT1G66400 147 / 2e-44 calmodulin like 23 (.1) Lus10042008 [exp] 61 / 3e-13 AT1G18210 138 / 1e-42 Calcium-binding EF-hand family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G126400 [exp] 135 / 1e-43 AT3G03430 132 / 3e-42 Calcium-binding EF-hand family protein (.1) Potri.004G089200 [exp] 131 / 7e-42 AT3G03430 128 / 2e-40 Calcium-binding EF-hand family protein (.1) Potri.015G039500 [exp] 69 / 3e-16 AT1G18210 189 / 6e-62 Calcium-binding EF-hand family protein (.1.2) Potri.017G126200 [exp] 69 / 3e-16 AT1G66400 155 / 5e-49 calmodulin like 23 (.1) Potri.010G107100 [exp] 66 / 9e-15 AT1G24620 220 / 2e-73 EF hand calcium-binding protein family (.1) Potri.008G134300 [exp] 66 / 1e-14 AT1G24620 219 / 2e-73 EF hand calcium-binding protein family (.1) Potri.004G089400 [exp] 62 / 1e-13 AT1G66400 157 / 7e-50 calmodulin like 23 (.1) Potri.012G048200 [exp] 61 / 3e-13 AT1G18210 188 / 8e-62 Calcium-binding EF-hand family protein (.1.2) Potri.002G239100 [exp] 58 / 5e-12 AT3G07490 248 / 8e-86 calmodulin-like 3, ARF-GAP domain 11 (.1) Potri.017G029700 [exp] 57 / 2e-11 AT3G07490 192 / 1e-62 calmodulin-like 3, ARF-GAP domain 11 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0220 [flax] [poplar] EF_hand PF00036 [flax] [poplar] EF-hand_1 EF hand
Representative CDS sequence Show only first row Show all	>Lus10009124 pacid=23150025 polypeptide=Lus10009124 locus=Lus10009124.g ID=Lus10009124.BGIv1.0 annot-version=v1.0 ATGGCTGACGACGAAGCACAAGAGCAGGCCGATAGGGAGCGCATCTTCAAGCGCTTCGACCTCAACGGCGACGGCAAGATCTCTGCCACCGAGCTTGGCG ACTGCCTCAAGACGCTGGGTTCCGTCACTCCCGAAGAGGTGAAGCGGATGATGGACGAGATCGACACCGACGGCGACGGCTACATTTCCTACCAGGAGTT CACCGACTTCGCCCTCGCCAACCGCGGCCTGATCAAAGACGTCGCCAAGATCTTCTAA
AA sequence Show only first row Show all	>Lus10009124 pacid=23150025 polypeptide=Lus10009124 locus=Lus10009124.g ID=Lus10009124.BGIv1.0 annot-version=v1.0 MADDEAQEQADRERIFKRFDLNGDGKISATELGDCLKTLGSVTPEEVKRMMDEIDTDGDGYISYQEFTDFALANRGLIKDVAKIF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G03430			Calcium-binding EF-hand family...		Lus10009124 [exp]	0	1
AT4G24050			NAD(P)-binding Rossmann-fold s...		Lus10017308 [exp]	33.9	0.5322
AT1G54460			TPX2 (targeting protein for Xk...		Lus10022003 [exp]	80.8	0.5079
AT1G75130		CYP721A1	"cytochrome P450, family 721, ...		Lus10010799 [exp]	127.2	0.4799
AT5G23850			Arabidopsis thaliana protein o...		Lus10039228 [exp]	144.3	0.4833
					Lus10032489 [exp]	207.0	0.4614

Compare expression of checked genes

Lus10009124 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.