Lus10009136 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G18620 176 / 2e-55 Terpenoid synthases superfamily protein (.1)
AT4G36810 174 / 3e-54 GGPS1 geranylgeranyl pyrophosphate synthase 1 (.1)
AT3G20160 168 / 3e-52 Terpenoid synthases superfamily protein (.1)
AT3G14510 166 / 6e-52 Polyprenyl synthetase family protein (.1)
AT3G14530 164 / 3e-50 Terpenoid synthases superfamily protein (.1)
AT3G14550 159 / 1e-48 GGPS3 geranylgeranyl pyrophosphate synthase 3 (.1)
AT2G23800 157 / 2e-47 GGPS5, GGPS2 GERANYLGERANYL PYROPHOSPHATE SYNTHASE 5, geranylgeranyl pyrophosphate synthase 2 (.1)
AT2G18640 154 / 1e-46 GGPS4 geranylgeranyl pyrophosphate synthase 4 (.1)
AT3G29430 147 / 5e-44 Terpenoid synthases superfamily protein (.1)
AT3G32040 146 / 1e-43 Terpenoid synthases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028509 261 / 4e-88 AT4G36810 437 / 2e-153 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10033582 255 / 4e-88 AT4G36810 305 / 6e-104 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10017624 254 / 2e-84 AT4G36810 439 / 5e-153 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10017625 247 / 1e-82 AT4G36810 423 / 5e-148 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10028508 221 / 1e-72 AT4G36810 380 / 9e-132 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10028507 204 / 6e-66 AT4G36810 375 / 2e-129 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10009138 197 / 3e-63 AT4G36810 373 / 2e-128 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10022499 184 / 4e-58 AT4G36810 491 / 8e-175 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10016803 183 / 1e-57 AT4G36810 488 / 2e-173 geranylgeranyl pyrophosphate synthase 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G090600 220 / 2e-72 AT4G36810 419 / 1e-146 geranylgeranyl pyrophosphate synthase 1 (.1)
Potri.017G124600 212 / 3e-69 AT4G36810 388 / 2e-134 geranylgeranyl pyrophosphate synthase 1 (.1)
Potri.017G124700 199 / 3e-64 AT4G36810 413 / 1e-144 geranylgeranyl pyrophosphate synthase 1 (.1)
Potri.005G127100 187 / 2e-59 AT4G36810 444 / 2e-156 geranylgeranyl pyrophosphate synthase 1 (.1)
Potri.007G031100 181 / 4e-57 AT4G36810 467 / 1e-165 geranylgeranyl pyrophosphate synthase 1 (.1)
Potri.004G179628 78 / 9e-18 AT4G38460 403 / 3e-141 geranylgeranyl reductase (.1)
Potri.009G139600 76 / 6e-17 AT4G38460 389 / 7e-136 geranylgeranyl reductase (.1)
Potri.001G380500 70 / 7e-15 AT1G78510 597 / 0.0 solanesyl diphosphate synthase 1 (.1.2)
Potri.011G099500 65 / 5e-13 AT1G78510 415 / 8e-144 solanesyl diphosphate synthase 1 (.1.2)
Potri.011G101200 64 / 6e-13 AT1G17050 397 / 2e-137 solanesyl diphosphate synthase 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0613 Terp_synthase PF00348 polyprenyl_synt Polyprenyl synthetase
Representative CDS sequence
>Lus10009136 pacid=23150074 polypeptide=Lus10009136 locus=Lus10009136.g ID=Lus10009136.BGIv1.0 annot-version=v1.0
ATGGAATGTCGATATGGCGAGAAAGTGAGTTTGGAGGACTTGGAGTACATCCACATCCACAAGACCGCGAGGCTGCTAGAGGCGGCGGTGGTTTGCGGGG
CGATCTTGGGGGGAGCCGACGACGAGAGCGTGAAGAAAGTGAGGAAATACTCGAGGTGCGTCGGATTACTATTCCAAGTGGTGGACGATATTCTAGACGT
GACGAAGTCCTCGGAGGAGTTGGGGAAGACCGCCGGCAAGGATCTGGCGACGGACAAGGCGACGTATCCGAAGCTGTTGGGTTTGGACGGCGCGAGAAAG
TTCGCAGCCAAGTTGGTGGATGAAGCCAATAAGGAGTTGGCTGGCTTTGATCCCGTGAAGGCAGCACCTCTCTATCATTTTGCTAATTACATTGCTACCC
GACAAAATTAA
AA sequence
>Lus10009136 pacid=23150074 polypeptide=Lus10009136 locus=Lus10009136.g ID=Lus10009136.BGIv1.0 annot-version=v1.0
MECRYGEKVSLEDLEYIHIHKTARLLEAAVVCGAILGGADDESVKKVRKYSRCVGLLFQVVDDILDVTKSSEELGKTAGKDLATDKATYPKLLGLDGARK
FAAKLVDEANKELAGFDPVKAAPLYHFANYIATRQN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G18620 Terpenoid synthases superfamil... Lus10009136 0 1
AT4G36810 GGPS1 geranylgeranyl pyrophosphate s... Lus10023259 1.0 0.9944
AT4G36810 GGPS1 geranylgeranyl pyrophosphate s... Lus10009137 2.0 0.9880
AT4G19880 Glutathione S-transferase fami... Lus10014304 2.4 0.9891
AT1G63970 MECPS, ISPF 2C-METHYL-D-ERYTHRITOL 2,4-CYC... Lus10028759 3.9 0.9885
AT1G10370 GST30B, ATGSTU1... GLUTATHIONE S-TRANSFERASE U17,... Lus10030805 4.5 0.9798
AT2G47140 AtSDR5 short-chain dehydrogenase redu... Lus10013593 4.5 0.9857
AT1G16120 WAKL1 wall associated kinase-like 1 ... Lus10008105 6.5 0.9847
Lus10000527 7.7 0.9812
AT2G02240 MEE66 maternal effect embryo arrest ... Lus10023207 8.0 0.9833
AT2G43840 UGT74F1 UDP-glycosyltransferase 74 F1 ... Lus10008742 8.8 0.9818

Lus10009136 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.