Lus10009137 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G36810 130 / 5e-37 GGPS1 geranylgeranyl pyrophosphate synthase 1 (.1)
AT2G18620 122 / 3e-34 Terpenoid synthases superfamily protein (.1)
AT2G23800 119 / 9e-33 GGPS5, GGPS2 GERANYLGERANYL PYROPHOSPHATE SYNTHASE 5, geranylgeranyl pyrophosphate synthase 2 (.1)
AT3G29430 118 / 1e-32 Terpenoid synthases superfamily protein (.1)
AT3G14530 117 / 3e-32 Terpenoid synthases superfamily protein (.1)
AT2G18640 117 / 3e-32 GGPS4 geranylgeranyl pyrophosphate synthase 4 (.1)
AT3G14550 115 / 2e-31 GGPS3 geranylgeranyl pyrophosphate synthase 3 (.1)
AT3G32040 113 / 1e-30 Terpenoid synthases superfamily protein (.1)
AT3G20160 107 / 2e-28 Terpenoid synthases superfamily protein (.1)
AT1G49530 93 / 3e-23 GGPS6 geranylgeranyl pyrophosphate synthase 6 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028509 213 / 4e-69 AT4G36810 437 / 2e-153 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10017624 151 / 3e-44 AT4G36810 439 / 5e-153 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10017625 144 / 3e-42 AT4G36810 423 / 5e-148 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10028508 138 / 4e-40 AT4G36810 380 / 9e-132 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10028507 136 / 2e-39 AT4G36810 375 / 2e-129 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10009138 135 / 4e-39 AT4G36810 373 / 2e-128 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10033581 129 / 1e-38 AT4G36810 120 / 4e-33 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10022499 120 / 2e-33 AT4G36810 491 / 8e-175 geranylgeranyl pyrophosphate synthase 1 (.1)
Lus10016803 120 / 3e-33 AT4G36810 488 / 2e-173 geranylgeranyl pyrophosphate synthase 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G090600 132 / 1e-37 AT4G36810 419 / 1e-146 geranylgeranyl pyrophosphate synthase 1 (.1)
Potri.017G124600 130 / 3e-37 AT4G36810 388 / 2e-134 geranylgeranyl pyrophosphate synthase 1 (.1)
Potri.005G127100 124 / 5e-35 AT4G36810 444 / 2e-156 geranylgeranyl pyrophosphate synthase 1 (.1)
Potri.017G124700 122 / 4e-34 AT4G36810 413 / 1e-144 geranylgeranyl pyrophosphate synthase 1 (.1)
Potri.007G031100 120 / 2e-33 AT4G36810 467 / 1e-165 geranylgeranyl pyrophosphate synthase 1 (.1)
Potri.009G139600 88 / 3e-21 AT4G38460 389 / 7e-136 geranylgeranyl reductase (.1)
Potri.004G179628 85 / 5e-20 AT4G38460 403 / 3e-141 geranylgeranyl reductase (.1)
Potri.015G043400 54 / 3e-09 AT4G38460 121 / 4e-32 geranylgeranyl reductase (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0613 Terp_synthase PF00348 polyprenyl_synt Polyprenyl synthetase
Representative CDS sequence
>Lus10009137 pacid=23150040 polypeptide=Lus10009137 locus=Lus10009137.g ID=Lus10009137.BGIv1.0 annot-version=v1.0
ATGGCTTCTTCTTCCTTCTCTACAGCTTCAGCCGCCATCTCTTCCTCTCATCTTCAACACTCCAAATTCGCTCTCCTCAAAATACATCCCTCCATCTTCA
ACAACAATCCCAAATCCCTATTACCCCAATTCAAACTCCGCGTTTCCGCCGCTGCCGCATCATCCTCTGTCTCTCCCCTGCAATTTGCCGACCAAACTCC
CCCCTCTCTCCCCGAGTTCGATTTCGGGGAGTACATGATCGCCAAGGCCGAGCGGGTCAACACGGCCCTCGAGGAGGCTATTCCGCTTCAGCGTCCGATC
AAAATCCACGAGGCGATGCGGTACTCCCTCCTCGCCGGCGGCAAGCGCGTCCGTCCCGTCCTCTGCATCGCCGCCTGCGAGATGGTCGGCGGCGACGACT
CGATCGCAATGCCGATGGCCTGCGCCACAGAGATGATTCACACCACCTAG
AA sequence
>Lus10009137 pacid=23150040 polypeptide=Lus10009137 locus=Lus10009137.g ID=Lus10009137.BGIv1.0 annot-version=v1.0
MASSSFSTASAAISSSHLQHSKFALLKIHPSIFNNNPKSLLPQFKLRVSAAAASSSVSPLQFADQTPPSLPEFDFGEYMIAKAERVNTALEEAIPLQRPI
KIHEAMRYSLLAGGKRVRPVLCIAACEMVGGDDSIAMPMACATEMIHTT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G36810 GGPS1 geranylgeranyl pyrophosphate s... Lus10009137 0 1
AT2G18620 Terpenoid synthases superfamil... Lus10009136 2.0 0.9880
AT4G36810 GGPS1 geranylgeranyl pyrophosphate s... Lus10023259 2.4 0.9851
AT1G10370 GST30B, ATGSTU1... GLUTATHIONE S-TRANSFERASE U17,... Lus10030805 2.8 0.9790
AT2G02240 MEE66 maternal effect embryo arrest ... Lus10023207 3.0 0.9842
AT2G47485 unknown protein Lus10009156 4.5 0.9771
AT5G36930 Disease resistance protein (TI... Lus10014671 8.9 0.9710
AT5G26340 ATSTP13, MSS1, ... SUGAR TRANSPORT PROTEIN 13, Ma... Lus10010534 11.2 0.9746
AT2G23770 protein kinase family protein ... Lus10000577 11.4 0.9729
AT4G11410 NAD(P)-binding Rossmann-fold s... Lus10035480 15.5 0.9685
AT1G16120 WAKL1 wall associated kinase-like 1 ... Lus10008105 15.9 0.9754

Lus10009137 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.