Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G50260 142 / 6e-43 CEP1 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1) AT3G48340 141 / 2e-42 CEP2 cysteine endopeptidase 2, Cysteine proteinases superfamily protein (.1) AT5G45890 139 / 2e-41 SAG12 senescence-associated gene 12 (.1) AT3G48350 132 / 9e-39 CEP3 cysteine endopeptidase 3, Cysteine proteinases superfamily protein (.1) AT5G43060 130 / 2e-37 Granulin repeat cysteine protease family protein (.1) AT3G19390 128 / 8e-37 Granulin repeat cysteine protease family protein (.1) AT1G47128 125 / 2e-35 RD21A, RD21 RESPONSIVE TO DEHYDRATION 21A, responsive to dehydration 21, Granulin repeat cysteine protease family protein (.1) AT4G36880 122 / 9e-35 CP1 cysteine proteinase1 (.1) AT4G35350 120 / 2e-34 XCP1 xylem cysteine peptidase 1 (.1.2) AT1G20850 120 / 2e-34 XCP2 xylem cysteine peptidase 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029799 [exp] 186 / 8e-60 AT5G45890 393 / 3e-137 senescence-associated gene 12 (.1) Lus10032406 [exp] 186 / 8e-60 AT5G45890 391 / 2e-136 senescence-associated gene 12 (.1) Lus10009145 [exp] 185 / 1e-59 AT5G45890 396 / 4e-138 senescence-associated gene 12 (.1) Lus10028501 [exp] 184 / 3e-59 AT5G45890 391 / 2e-136 senescence-associated gene 12 (.1) Lus10028502 [exp] 184 / 3e-59 AT5G45890 394 / 3e-137 senescence-associated gene 12 (.1) Lus10004781 [exp] 182 / 6e-59 AT5G45890 227 / 7e-73 senescence-associated gene 12 (.1) Lus10020722 [exp] 183 / 7e-59 AT5G45890 392 / 1e-136 senescence-associated gene 12 (.1) Lus10042295 [exp] 183 / 1e-58 AT5G45890 402 / 7e-141 senescence-associated gene 12 (.1) Lus10026073 [exp] 182 / 1e-58 AT5G45890 393 / 5e-137 senescence-associated gene 12 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G075100 [exp] 164 / 7e-52 AT5G45890 371 / 4e-129 senescence-associated gene 12 (.1) Potri.005G089100 [exp] 165 / 8e-52 AT5G45890 405 / 1e-141 senescence-associated gene 12 (.1) Potri.007G076000 [exp] 164 / 1e-51 AT5G45890 407 / 2e-142 senescence-associated gene 12 (.1) Potri.007G076100 [exp] 164 / 2e-51 AT5G45890 411 / 7e-144 senescence-associated gene 12 (.1) Potri.007G075900 [exp] 164 / 2e-51 AT5G45890 411 / 7e-144 senescence-associated gene 12 (.1) Potri.007G075300 [exp] 164 / 2e-51 AT5G45890 406 / 6e-142 senescence-associated gene 12 (.1) Potri.005G088600 [exp] 162 / 2e-50 AT5G45890 406 / 8e-142 senescence-associated gene 12 (.1) Potri.013G118200 [exp] 157 / 4e-49 AT5G45890 387 / 2e-135 senescence-associated gene 12 (.1) Potri.013G118400 [exp] 154 / 2e-47 AT5G45890 378 / 2e-131 senescence-associated gene 12 (.1) Potri.011G064900 [exp] 154 / 2e-47 AT5G45890 401 / 3e-140 senescence-associated gene 12 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0125 [flax] [poplar] Peptidase_CA PF00112 [flax] [poplar] Peptidase_C1 Papain family cysteine protease
Representative CDS sequence Show only first row Show all	>Lus10009143 pacid=23150035 polypeptide=Lus10009143 locus=Lus10009144.g ID=Lus10009143.BGIv1.0 annot-version=v1.0 ATGAAGGCAGTGGCGAGCCAACCGATTTCGGTGGCCATTGATGCAGGGGATTCATCGTTCCAATTCTACTCGAGTGGGATTTTTACAGGAGAATGCGGGA CTGAGCTAGACCATGGAGTGACGGCAGTTGGGTACGGTGAGAGCGGTGGGAAGAAGTACTGGTTGGTGAAGAATGCGTGGGGAGCACAGTCGGGCGAAGC CGGATACATTCGAATGCAGAAAGACATGCCCGCTAAAGAAGGCCTCTGCGGAATCGCTATGCAGGCTTCCTATCCTACTGCTTGA
AA sequence Show only first row Show all	>Lus10009143 pacid=23150035 polypeptide=Lus10009143 locus=Lus10009144.g ID=Lus10009143.BGIv1.0 annot-version=v1.0 MKAVASQPISVAIDAGDSSFQFYSSGIFTGECGTELDHGVTAVGYGESGGKKYWLVKNAWGAQSGEAGYIRMQKDMPAKEGLCGIAMQASYPTA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G45890		SAG12	senescence-associated gene 12 ...		Lus10009143 [exp]	0	1
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10029390 [exp]	11.7	0.5863
AT5G33340		CDR1	CONSTITUTIVE DISEASE RESISTANC...		Lus10029913 [exp]	16.6	0.5863
					Lus10000400 [exp]	20.3	0.5863
AT4G29280		LCR22	low-molecular-weight cysteine-...		Lus10015983 [exp]	23.5	0.5863
AT2G29110		ATGLR2.8	glutamate receptor 2.8 (.1)		Lus10026877 [exp]	26.3	0.5863
					Lus10001882 [exp]	26.7	0.5045
AT5G18460			Protein of Unknown Function (D...		Lus10006860 [exp]	28.8	0.5863
					Lus10002646 [exp]	29.8	0.5657
					Lus10009372 [exp]	31.1	0.5863
AT3G45600		TET3	tetraspanin3 (.1)		Lus10023218 [exp]	34.6	0.5775

Compare expression of checked genes

Lus10009143 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.