Lus10009144 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G35350 139 / 2e-41 XCP1 xylem cysteine peptidase 1 (.1.2)
AT5G50260 140 / 5e-41 CEP1 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
AT5G45890 138 / 1e-40 SAG12 senescence-associated gene 12 (.1)
AT3G19390 140 / 2e-40 Granulin repeat cysteine protease family protein (.1)
AT3G48340 138 / 2e-40 CEP2 cysteine endopeptidase 2, Cysteine proteinases superfamily protein (.1)
AT3G48350 137 / 7e-40 CEP3 cysteine endopeptidase 3, Cysteine proteinases superfamily protein (.1)
AT2G27420 136 / 1e-39 Cysteine proteinases superfamily protein (.1)
AT1G20850 132 / 4e-38 XCP2 xylem cysteine peptidase 2 (.1)
AT4G36880 132 / 4e-38 CP1 cysteine proteinase1 (.1)
AT1G09850 132 / 1e-37 XBCP3 xylem bark cysteine peptidase 3 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028501 226 / 5e-75 AT5G45890 391 / 2e-136 senescence-associated gene 12 (.1)
Lus10009145 227 / 6e-75 AT5G45890 396 / 4e-138 senescence-associated gene 12 (.1)
Lus10028502 226 / 1e-74 AT5G45890 394 / 3e-137 senescence-associated gene 12 (.1)
Lus10026073 224 / 4e-74 AT5G45890 393 / 5e-137 senescence-associated gene 12 (.1)
Lus10020722 224 / 7e-74 AT5G45890 392 / 1e-136 senescence-associated gene 12 (.1)
Lus10029799 223 / 1e-73 AT5G45890 393 / 3e-137 senescence-associated gene 12 (.1)
Lus10026362 223 / 1e-73 AT5G45890 396 / 2e-138 senescence-associated gene 12 (.1)
Lus10032406 223 / 2e-73 AT5G45890 391 / 2e-136 senescence-associated gene 12 (.1)
Lus10006542 222 / 4e-73 AT5G45890 391 / 2e-136 senescence-associated gene 12 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G088600 203 / 2e-65 AT5G45890 406 / 8e-142 senescence-associated gene 12 (.1)
Potri.005G089100 202 / 2e-65 AT5G45890 405 / 1e-141 senescence-associated gene 12 (.1)
Potri.007G075300 200 / 2e-64 AT5G45890 406 / 6e-142 senescence-associated gene 12 (.1)
Potri.007G076000 198 / 8e-64 AT5G45890 407 / 2e-142 senescence-associated gene 12 (.1)
Potri.007G076100 198 / 1e-63 AT5G45890 411 / 7e-144 senescence-associated gene 12 (.1)
Potri.007G075900 198 / 1e-63 AT5G45890 411 / 7e-144 senescence-associated gene 12 (.1)
Potri.011G064900 189 / 1e-60 AT5G45890 401 / 3e-140 senescence-associated gene 12 (.1)
Potri.013G118200 176 / 7e-56 AT5G45890 387 / 2e-135 senescence-associated gene 12 (.1)
Potri.013G126100 174 / 1e-54 AT5G45890 386 / 2e-134 senescence-associated gene 12 (.1)
Potri.013G118400 171 / 2e-53 AT5G45890 378 / 2e-131 senescence-associated gene 12 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF00112 Peptidase_C1 Papain family cysteine protease
Representative CDS sequence
>Lus10009144 pacid=23150034 polypeptide=Lus10009144 locus=Lus10009144.g ID=Lus10009144.BGIv1.0 annot-version=v1.0
ATGTGCTCTCCGCAACATGGACCTTTTAGGTACGAAAATGTGAGTGCGGTCCCCACGACCATGGACTGGAGGAAGAAGGGAGCAGTGACCCCTATCAAAG
ACCAAGGTCAATGCGGAAGCTGCTGGGCATTTTCCGCAGTAGGAGCAATGGAAGGAATCCACCAGCTCAGTACTGGCAAATTGGCGTCCCTTTCGGAGCA
AGAATTGGTTGACTGCGACACCAAGGGAGAGGACCAAGGATGTGGCGGCGGGTTGATGGATGATGCGTTCAAGTTCATCATTCAAAACAAGGGATTGACC
ACCGAGACCAACTACCTTACGACGCCGCCGATGGAACCTGTAATGCCAACAAAGAAGGAAGCAGTGCGGCCAAGATTACCGGGTACTAAGATGTGCCAGC
CAACAACGAAGCCGCATTGA
AA sequence
>Lus10009144 pacid=23150034 polypeptide=Lus10009144 locus=Lus10009144.g ID=Lus10009144.BGIv1.0 annot-version=v1.0
MCSPQHGPFRYENVSAVPTTMDWRKKGAVTPIKDQGQCGSCWAFSAVGAMEGIHQLSTGKLASLSEQELVDCDTKGEDQGCGGGLMDDAFKFIIQNKGLT
TETNYLTTPPMEPVMPTKKEAVRPRLPGTKMCQPTTKPH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G50260 CEP1 cysteine endopeptidase 1, Cyst... Lus10009144 0 1
AT5G67360 ARA12 Subtilase family protein (.1) Lus10002392 6.6 0.6674
AT3G53240 AtRLP45 receptor like protein 45 (.1) Lus10043328 10.8 0.6232
AT3G02100 UDP-Glycosyltransferase superf... Lus10015753 16.4 0.6267
AT1G16930 F-box/RNI-like/FBD-like domain... Lus10008524 17.5 0.6132
AT4G37770 ACS8 1-amino-cyclopropane-1-carboxy... Lus10039647 19.7 0.6361
Lus10027052 23.9 0.5678
AT5G45340 CYP707A3 "cytochrome P450, family 707, ... Lus10034768 26.3 0.6015
AT3G26470 Powdery mildew resistance prot... Lus10021768 30.6 0.5874
AT4G21200 ATGA2OX8 ARABIDOPSIS THALIANA GIBBERELL... Lus10030567 33.6 0.5787
AT5G67360 ARA12 Subtilase family protein (.1) Lus10002398 35.4 0.5993

Lus10009144 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.