Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G64130 112 / 3e-33 cAMP-regulated phosphoprotein 19-related protein (.1.2.3) AT1G69510 85 / 2e-22 cAMP-regulated phosphoprotein 19-related protein (.1.2.3) AT4G16146 49 / 1e-08 cAMP-regulated phosphoprotein 19-related protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028499 [exp] 136 / 4e-43 AT5G64130 143 / 2e-45 cAMP-regulated phosphoprotein 19-related protein (.1.2.3) Lus10030448 [exp] 76 / 1e-18 AT1G69510 123 / 1e-36 cAMP-regulated phosphoprotein 19-related protein (.1.2.3) Lus10026615 [exp] 76 / 2e-18 AT1G69510 123 / 1e-36 cAMP-regulated phosphoprotein 19-related protein (.1.2.3) Lus10036768 [exp] 73 / 6e-18 AT5G64130 116 / 6e-35 cAMP-regulated phosphoprotein 19-related protein (.1.2.3) Lus10037162 [exp] 71 / 2e-15 AT1G69523 268 / 4e-84 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Lus10037727 [exp] 49 / 7e-08 AT5G49350 136 / 1e-38 Glycine-rich protein family (.1.2) Lus10016857 [exp] 47 / 4e-07 AT5G49350 138 / 3e-40 Glycine-rich protein family (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G111900 [exp] 130 / 2e-40 AT5G64130 152 / 4e-49 cAMP-regulated phosphoprotein 19-related protein (.1.2.3) Potri.017G102700 [exp] 125 / 2e-38 AT5G64130 159 / 1e-51 cAMP-regulated phosphoprotein 19-related protein (.1.2.3) Potri.010G167000 [exp] 87 / 1e-22 AT1G69510 104 / 4e-29 cAMP-regulated phosphoprotein 19-related protein (.1.2.3) Potri.010G141300 [exp] 58 / 3e-12 AT4G16146 105 / 3e-31 cAMP-regulated phosphoprotein 19-related protein (.1) Potri.008G108201 [exp] 54 / 8e-11 AT4G16146 103 / 4e-30 cAMP-regulated phosphoprotein 19-related protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04667 [flax] [poplar] Endosulfine cAMP-regulated phosphoprotein/endosulfine conserved region
Representative CDS sequence Show only first row Show all	>Lus10009146 pacid=23150043 polypeptide=Lus10009146 locus=Lus10009146.g ID=Lus10009146.BGIv1.0 annot-version=v1.0 ATGGATGATAGCGAGGATAAAAAATCTGCACCACCTTCTAAAGAAGAGGAAGAAGCTATGAAGAAAAAGTACGGTGGTCTCTTGCCTAAGAAACCGCCAC TCATTTCCAAGGATCACGAACGTGCGTACTTTGATTCTGCTGATTGGGCACTTGGAAAGCAAGGTGTTGAGAAGCCTAAAGGACCGCTTGAAGCTCTTCG CCCCAAATTGCAGCCGACACAGCAGCAGACACGGTACCGGAAGTCTCCATATGCTCCATCAGACGGTGAAGGTGTAGGAGGTAGCACATCTGAGGATGCA GCTCCGAACGAATGA
AA sequence Show only first row Show all	>Lus10009146 pacid=23150043 polypeptide=Lus10009146 locus=Lus10009146.g ID=Lus10009146.BGIv1.0 annot-version=v1.0 MDDSEDKKSAPPSKEEEEAMKKKYGGLLPKKPPLISKDHERAYFDSADWALGKQGVEKPKGPLEALRPKLQPTQQQTRYRKSPYAPSDGEGVGGSTSEDA APNE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G64130			cAMP-regulated phosphoprotein ...		Lus10009146 [exp]	0	1
AT4G14723		EPFL4, CLL2	epidermal patterning factor li...		Lus10041186 [exp]	12.2	0.7612
AT3G01180		ATSS2	starch synthase 2 (.1)		Lus10015371 [exp]	12.5	0.6878
AT3G15095		HCF243	high chlorophyll fluorescence ...		Lus10013679 [exp]	15.9	0.6662
AT1G32240	GARP	KAN2, KANADI2	KANADI 2, Homeodomain-like sup...		Lus10030989 [exp]	20.4	0.7356
AT5G64130			cAMP-regulated phosphoprotein ...		Lus10028499 [exp]	21.9	0.6513
AT1G62760			Plant invertase/pectin methyle...		Lus10031132 [exp]	21.9	0.7460
AT3G13620			Amino acid permease family pro...		Lus10034046 [exp]	25.2	0.7450
AT5G17520		MEX1, RCP1	MALTOSE EXCESS 1, root cap 1 (...		Lus10020364 [exp]	25.9	0.6934
AT4G27620			unknown protein		Lus10028872 [exp]	28.5	0.7205
AT3G54900		ATGRXCP, CXIP1	GLUTAREDOXIN, CAX interacting ...		Lus10041501 [exp]	30.3	0.6983

Compare expression of checked genes

Lus10009146 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.