Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G66880 75 / 2e-17 Protein kinase superfamily protein (.1) AT5G38210 73 / 1e-16 Protein kinase family protein (.1) AT1G25390 49 / 4e-08 Protein kinase superfamily protein (.1) AT1G69910 43 / 4e-06 Protein kinase superfamily protein (.1) AT1G18390 42 / 7e-06 Protein kinase superfamily protein (.1.2) AT5G66790 40 / 7e-05 Protein kinase superfamily protein (.1) AT2G28930 39 / 9e-05 APK1B protein kinase 1B (.1.2.3) AT2G23450 39 / 0.0001 Protein kinase superfamily protein (.1.2) AT2G17220 38 / 0.0002 Kin3 kinase 3, Protein kinase superfamily protein (.1.2) AT3G49670 36 / 0.001 BAM2 BARELY ANY MERISTEM 2, Leucine-rich receptor-like protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028495 [exp] 159 / 7e-53 AT5G38210 76 / 1e-17 Protein kinase family protein (.1) Lus10029132 [exp] 54 / 7e-10 AT1G18390 537 / 0.0 Protein kinase superfamily protein (.1.2) Lus10016737 [exp] 47 / 2e-07 AT1G18390 544 / 0.0 Protein kinase superfamily protein (.1.2) Lus10022432 [exp] 47 / 2e-07 AT1G18390 543 / 0.0 Protein kinase superfamily protein (.1.2) Lus10011652 [exp] 41 / 3e-05 AT2G23450 337 / 2e-111 Protein kinase superfamily protein (.1.2) Lus10004964 [exp] 38 / 0.0002 AT2G28930 570 / 0.0 protein kinase 1B (.1.2.3) Lus10038087 [exp] 38 / 0.0002 AT5G15080 499 / 6e-175 Protein kinase superfamily protein (.1) Lus10005462 [exp] 38 / 0.0003 AT2G28930 569 / 0.0 protein kinase 1B (.1.2.3) Lus10006643 [exp] 38 / 0.0004 AT5G15080 495 / 2e-173 Protein kinase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G096550 [exp] 90 / 1e-22 AT5G38210 594 / 0.0 Protein kinase family protein (.1) Potri.017G118100 [exp] 89 / 2e-22 AT5G38210 575 / 0.0 Protein kinase family protein (.1) Potri.004G096900 [exp] 87 / 1e-21 AT5G38210 557 / 0.0 Protein kinase family protein (.1) Potri.017G118250 [exp] 86 / 4e-21 AT5G38210 542 / 0.0 Protein kinase family protein (.1) Potri.012G054725 [exp] 59 / 1e-11 AT1G18390 516 / 2e-176 Protein kinase superfamily protein (.1.2) Potri.015G044750 [exp] 56 / 1e-10 AT1G18390 532 / 0.0 Protein kinase superfamily protein (.1.2) Potri.004G097100 [exp] 56 / 1e-10 AT5G38210 525 / 4e-179 Protein kinase family protein (.1) Potri.010G121100 [exp] 54 / 7e-10 AT1G25390 524 / 1e-179 Protein kinase superfamily protein (.1) Potri.015G045101 [exp] 51 / 7e-09 AT1G18390 659 / 0.0 Protein kinase superfamily protein (.1.2) Potri.010G120800 [exp] 46 / 5e-07 AT1G18390 525 / 2e-178 Protein kinase superfamily protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10009149 pacid=23150013 polypeptide=Lus10009149 locus=Lus10009149.g ID=Lus10009149.BGIv1.0 annot-version=v1.0 ATGGTGACGTCGGTGGCTGAGCTGGCGTTCAGGTGTCTGCAACAGGAGAGAGATAAGAGGCCTACCATGAACGAGGTTGTGGGGATGCTGAAGAGGATTG AGAAGGAGAATGAATTGGGGGATCTCCAGCAGAAGGCTGAGGTTGTTGATATTGCTAAAGATGATGTTGGCTTGCTGCAGAACTTTTCTCCTCCGGTGCT CTCCCCCGACTCTGGAGGCAATGACAAATGGAATAAGGTGATGAGGACGATGTGA
AA sequence Show only first row Show all	>Lus10009149 pacid=23150013 polypeptide=Lus10009149 locus=Lus10009149.g ID=Lus10009149.BGIv1.0 annot-version=v1.0 MVTSVAELAFRCLQQERDKRPTMNEVVGMLKRIEKENELGDLQQKAEVVDIAKDDVGLLQNFSPPVLSPDSGGNDKWNKVMRTM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G66880			Protein kinase superfamily pro...		Lus10009149 [exp]	0	1
AT1G66880			Protein kinase superfamily pro...		Lus10009150 [exp]	1.0	0.8976
AT5G59320		LTP3	lipid transfer protein 3 (.1)		Lus10008606 [exp]	22.6	0.7978
AT5G47230	AP2_ERF	ATERF5, ATERF-5...	ETHYLENE RESPONSIVE ELEMENT BI...		Lus10007841 [exp]	22.7	0.8102
AT3G10130			SOUL heme-binding family prote...		Lus10014203 [exp]	24.2	0.7014
AT5G06720		ATPA2	peroxidase 2 (.1)		Lus10008167 [exp]	26.6	0.7762
AT5G51950			Glucose-methanol-choline (GMC)...		Lus10015012 [exp]	41.3	0.7912
AT5G13220	ZIM	JAS1, TIFY9, JA...	TIFY DOMAIN PROTEIN 9, JASMONA...		Lus10002576 [exp]	41.4	0.7474
					Lus10000890 [exp]	44.0	0.7341
AT1G26680	B3	REM17	transcriptional factor B3 fami...		Lus10026234 [exp]	64.2	0.7553
AT1G14190			Glucose-methanol-choline (GMC)...		Lus10026606 [exp]	70.7	0.7033

Compare expression of checked genes

Lus10009149 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.