Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036283 [exp] 68 / 1e-15 ND / Lus10010830 [exp] 62 / 2e-13 ND / Lus10012486 [exp] 57 / 3e-11 ND / Lus10033073 [exp] 52 / 1e-09 ND / Lus10038705 [exp] 52 / 3e-09 ND / Lus10006022 [exp] 46 / 2e-07 ND / Lus10010234 [exp] 42 / 1e-05 ND / Lus10021588 [exp] 40 / 2e-05 ND / Lus10024764 [exp] 38 / 0.0003 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10009177 pacid=23154478 polypeptide=Lus10009177 locus=Lus10009177.g ID=Lus10009177.BGIv1.0 annot-version=v1.0 ATGGGTGAGCCGATCCAACACAAGAACCTCTTAGCTCTCATCCTCCAGACCTTTTCCTTCAACTCCACCCCAAAGGTCCTCCCATGTAGTGCCTACATCA CCCAGATCATGCTCCACTTCGACCTTCTTCATCACTATGCCCATGACTGTATAGTAGCGTGTGACCTACTCTACAGGTTATATCAGGCTCATACAGGACG TGTGACTATGCCTAAAGATGCTGCTCACACAGTATTCATGGGTGGTTTCATAGTCTGA
AA sequence Show only first row Show all	>Lus10009177 pacid=23154478 polypeptide=Lus10009177 locus=Lus10009177.g ID=Lus10009177.BGIv1.0 annot-version=v1.0 MGEPIQHKNLLALILQTFSFNSTPKVLPCSAYITQIMLHFDLLHHYAHDCIVACDLLYRLYQAHTGRVTMPKDAAHTVFMGGFIV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10009177 [exp]	0	1
AT5G49330	MYB	PFG3, ATMYB111	PRODUCTION OF FLAVONOL GLYCOSI...		Lus10000008 [exp]	2.0	1.0000
					Lus10001123 [exp]	3.9	1.0000
AT1G54130		AT-RSH3, RSH3, ...	RELA/SPOT homolog 3 (.1)		Lus10011252 [exp]	4.0	1.0000
AT1G47550		SEC3A	exocyst complex component sec3...		Lus10001022 [exp]	4.5	1.0000
					Lus10023352 [exp]	5.0	1.0000
					Lus10026785 [exp]	5.3	1.0000
AT5G38435		SPH8	S-protein homologue 8 (.1)		Lus10029384 [exp]	6.0	1.0000
					Lus10028048 [exp]	6.9	1.0000
AT3G14040			Pectin lyase-like superfamily ...		Lus10039150 [exp]	6.9	1.0000
					Lus10024677 [exp]	7.2	0.9907

Compare expression of checked genes

Lus10009177 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.