Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G04790 126 / 1e-37 EMB3119 EMBRYO DEFECTIVE 3119, Ribose 5-phosphate isomerase, type A protein (.1) AT1G71100 84 / 4e-21 RSW10 RADIAL SWELLING 10, Ribose 5-phosphate isomerase, type A protein (.1) AT2G01290 82 / 1e-20 RPI2 ribose-5-phosphate isomerase 2 (.1) AT5G44520 40 / 4e-05 NagB/RpiA/CoA transferase-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015919 [exp] 162 / 3e-51 AT3G04790 390 / 4e-138 EMBRYO DEFECTIVE 3119, Ribose 5-phosphate isomerase, type A protein (.1) Lus10032450 [exp] 81 / 6e-20 AT1G71100 362 / 3e-127 RADIAL SWELLING 10, Ribose 5-phosphate isomerase, type A protein (.1) Lus10042951 [exp] 81 / 6e-20 AT1G71100 356 / 4e-125 RADIAL SWELLING 10, Ribose 5-phosphate isomerase, type A protein (.1) Lus10036094 [exp] 80 / 7e-20 AT2G01290 342 / 2e-119 ribose-5-phosphate isomerase 2 (.1) Lus10026777 [exp] 75 / 8e-18 AT1G71100 344 / 3e-120 RADIAL SWELLING 10, Ribose 5-phosphate isomerase, type A protein (.1) Lus10009180 [exp] 63 / 2e-13 AT3G04790 318 / 8e-110 EMBRYO DEFECTIVE 3119, Ribose 5-phosphate isomerase, type A protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G039400 [exp] 140 / 6e-43 AT3G04790 379 / 2e-133 EMBRYO DEFECTIVE 3119, Ribose 5-phosphate isomerase, type A protein (.1) Potri.005G052000 [exp] 140 / 7e-43 AT3G04790 354 / 9e-124 EMBRYO DEFECTIVE 3119, Ribose 5-phosphate isomerase, type A protein (.1) Potri.001G225700 [exp] 84 / 3e-21 AT2G01290 378 / 1e-133 ribose-5-phosphate isomerase 2 (.1) Potri.010G115300 [exp] 83 / 5e-21 AT2G01290 368 / 1e-129 ribose-5-phosphate isomerase 2 (.1) Potri.008G127600 [exp] 82 / 1e-20 AT2G01290 365 / 2e-128 ribose-5-phosphate isomerase 2 (.1) Potri.011G155500 [exp] 40 / 3e-05 AT5G44520 294 / 7e-100 NagB/RpiA/CoA transferase-like superfamily protein (.1) Potri.006G039800 [exp] 39 / 6e-05 AT1G71100 122 / 2e-31 RADIAL SWELLING 10, Ribose 5-phosphate isomerase, type A protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0246 [flax] [poplar] ISOCOT_Fold PF06026 [flax] [poplar] Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Representative CDS sequence Show only first row Show all	>Lus10009181 pacid=23154469 polypeptide=Lus10009181 locus=Lus10009181.g ID=Lus10009181.BGIv1.0 annot-version=v1.0 ATGTTTAAGGAAGAAGGTGTGGATGCAAAATTGAGGGTTAACGAGGATGGGAAGCCCTACGTGACTGACAACTCCAACTACATTGTGGACCTTTACTTCC AGACTCCGATCAGAGATGGATATGCTGCCGGGAAGGAGATTCTGTCTTTTGAAGGAGTGGTAGAACATGGGTTGTTTTTGGATATGGCTACGGCGGTGAT TATTGCAGGGAAGAGTGGCGTGGAAGTGAAAAGCAAGTGA
AA sequence Show only first row Show all	>Lus10009181 pacid=23154469 polypeptide=Lus10009181 locus=Lus10009181.g ID=Lus10009181.BGIv1.0 annot-version=v1.0 MFKEEGVDAKLRVNEDGKPYVTDNSNYIVDLYFQTPIRDGYAAGKEILSFEGVVEHGLFLDMATAVIIAGKSGVEVKSK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G04790		EMB3119	EMBRYO DEFECTIVE 3119, Ribose ...		Lus10009181 [exp]	0	1
AT2G40490		HEME2	Uroporphyrinogen decarboxylase...		Lus10012892 [exp]	3.5	0.9151
AT1G15820		CP24, LHCB6	light harvesting complex photo...		Lus10020418 [exp]	3.6	0.9195
AT4G28660		PSB28	photosystem II reaction center...		Lus10024959 [exp]	4.9	0.9001
AT5G66530			Galactose mutarotase-like supe...		Lus10028310 [exp]	9.5	0.8722
AT2G30570		PSBW	photosystem II reaction center...		Lus10018771 [exp]	9.5	0.8942
AT4G37200		HCF164	HIGH CHLOROPHYLL FLUORESCENCE ...		Lus10016780 [exp]	13.0	0.8732
AT2G30570		PSBW	photosystem II reaction center...		Lus10024858 [exp]	14.7	0.9028
AT3G04790		EMB3119	EMBRYO DEFECTIVE 3119, Ribose ...		Lus10009180 [exp]	15.3	0.8460
AT1G15820		CP24, LHCB6	light harvesting complex photo...		Lus10015831 [exp]	18.5	0.8908
AT1G15820		CP24, LHCB6	light harvesting complex photo...		Lus10015834 [exp]	18.7	0.8758

Compare expression of checked genes

Lus10009181 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.