Lus10009183 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G17530 145 / 3e-44 ATTIM23-1 translocase of inner mitochondrial membrane 23 (.1)
AT1G72750 141 / 7e-43 ATTIM23-2 translocase inner membrane subunit 23-2 (.1)
AT3G04800 128 / 1e-37 ATTIM23-3 translocase inner membrane subunit 23-3 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006020 139 / 5e-42 AT1G17530 248 / 1e-84 translocase of inner mitochondrial membrane 23 (.1)
Lus10008470 135 / 2e-40 AT1G17530 244 / 3e-83 translocase of inner mitochondrial membrane 23 (.1)
Lus10015922 66 / 1e-14 AT1G17530 61 / 4e-13 translocase of inner mitochondrial membrane 23 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G039200 199 / 8e-66 AT3G04800 190 / 5e-62 translocase inner membrane subunit 23-3 (.1)
Potri.005G051800 196 / 1e-64 AT3G04800 187 / 4e-61 translocase inner membrane subunit 23-3 (.1)
Potri.001G198100 138 / 2e-41 AT1G17530 154 / 6e-48 translocase of inner mitochondrial membrane 23 (.1)
Potri.003G044100 137 / 3e-41 AT1G17530 179 / 9e-58 translocase of inner mitochondrial membrane 23 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02466 Tim17 Tim17/Tim22/Tim23/Pmp24 family
Representative CDS sequence
>Lus10009183 pacid=23154466 polypeptide=Lus10009183 locus=Lus10009183.g ID=Lus10009183.BGIv1.0 annot-version=v1.0
ATGGGCGAACCAGACGATCAGAGGTACAGGAAGTACCATCCCTATCAAGATTTCTACAGCGTTCCTTCACAAAGCCTCTACAATCTGCCGACCTCCCCTG
AATTCCTCTTTCAGGAAGAAGCAGCTCGCCAACGCCGAACCTGGAGCGAGAATCTCACCTATTACACCGGCGCCGGCTATCTTGGCGGTGCGATCATCGG
TGGTACCATGGGGACTTTCCAAGGGATCAAGGCAGCGGAGGCCGGTGACACCTTAAAATTGCGTCTTAACAGGGTTCTCAACTCCGGCGGGCATTCGGGT
CGGCGTTTCGCGAACAATATGGGGGTATTGGGCCTGATGTTTGTTGGGATCGAGAGCAGCTTGATAGCGTTGAGGGATACGGATGACTTGGTGAACACCG
TTGTTGCTGGGCTTGGCACTGGGGCAGTTTATCGAGCAGCTAGAGGGCCTAGATCTGCTGCAATTGCTGGCGCCATTGGAGGAATTGCTGCGACCGCTGC
TGTGGCTGGGAAGCATGCTGTCAAGAGATATGTTCTTGCGTAG
AA sequence
>Lus10009183 pacid=23154466 polypeptide=Lus10009183 locus=Lus10009183.g ID=Lus10009183.BGIv1.0 annot-version=v1.0
MGEPDDQRYRKYHPYQDFYSVPSQSLYNLPTSPEFLFQEEAARQRRTWSENLTYYTGAGYLGGAIIGGTMGTFQGIKAAEAGDTLKLRLNRVLNSGGHSG
RRFANNMGVLGLMFVGIESSLIALRDTDDLVNTVVAGLGTGAVYRAARGPRSAAIAGAIGGIAATAAVAGKHAVKRYVLA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G17530 ATTIM23-1 translocase of inner mitochond... Lus10009183 0 1
AT1G71100 RSW10 RADIAL SWELLING 10, Ribose 5-p... Lus10042951 1.4 0.9086
AT3G15210 AP2_ERF ATERF4, RAP2.5... RELATED TO AP2 5, ethylene res... Lus10033664 4.0 0.8819
AT1G23820 SPDS1 spermidine synthase 1 (.1.2) Lus10030861 4.9 0.8877
AT4G19460 UDP-Glycosyltransferase superf... Lus10034760 6.0 0.8705
AT1G77490 TAPX thylakoidal ascorbate peroxida... Lus10025680 6.7 0.8540
AT3G23250 MYB ATMYB15, ATY19 myb domain protein 15 (.1.2) Lus10003557 6.9 0.8957
AT1G08410 P-loop containing nucleoside t... Lus10004103 12.7 0.7880
AT3G10480 NAC ANAC050 NAC domain containing protein ... Lus10033676 13.2 0.8054
AT1G70310 SPDS2 spermidine synthase 2 (.1) Lus10030629 13.6 0.8555
AT5G58730 pfkB-like carbohydrate kinase ... Lus10018235 16.0 0.8744

Lus10009183 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.