Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G53250 62 / 1e-13 SAUR-like auxin-responsive protein family (.1) AT5G03310 60 / 1e-12 SAUR-like auxin-responsive protein family (.1) AT2G37030 60 / 1e-12 SAUR-like auxin-responsive protein family (.1) AT1G75590 51 / 5e-09 SAUR-like auxin-responsive protein family (.1) AT1G19840 50 / 7e-09 SAUR-like auxin-responsive protein family (.1) AT4G34810 49 / 1e-08 SAUR-like auxin-responsive protein family (.1) AT4G38850 47 / 5e-08 SAUR-AC1, ATSAUR15, ATSR15AU, SAUR15, SAUR_AC1 SMALL AUXIN UP RNA 1 FROM ARABIDOPSIS THALIANA ECOTYPE COLUMBIA, ARABIDOPSIS COLUMBIA SAUR GENE 1, ARABIDOPSIS THALIANA SMALL AUXIN UPREGULATED 15, SAUR-like auxin-responsive protein family (.1) AT4G38840 47 / 6e-08 SAUR-like auxin-responsive protein family (.1) AT4G34780 47 / 6e-08 SAUR-like auxin-responsive protein family (.1) AT5G18020 47 / 8e-08 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037990 [exp] 137 / 3e-43 AT5G03310 77 / 8e-20 SAUR-like auxin-responsive protein family (.1) Lus10026521 [exp] 69 / 3e-16 AT2G37030 139 / 8e-44 SAUR-like auxin-responsive protein family (.1) Lus10013808 [exp] 69 / 4e-16 AT2G37030 141 / 1e-44 SAUR-like auxin-responsive protein family (.1) Lus10034507 [exp] 54 / 7e-10 AT1G75590 189 / 1e-62 SAUR-like auxin-responsive protein family (.1) Lus10033161 [exp] 53 / 1e-09 AT1G75590 187 / 4e-62 SAUR-like auxin-responsive protein family (.1) Lus10038193 [exp] 51 / 2e-09 AT4G38840 121 / 3e-37 SAUR-like auxin-responsive protein family (.1) Lus10008996 [exp] 50 / 4e-09 AT4G38840 116 / 2e-35 SAUR-like auxin-responsive protein family (.1) Lus10007560 [exp] 50 / 7e-09 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1) Lus10042376 [exp] 50 / 1e-08 AT4G34770 136 / 3e-43 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G224500 [exp] 67 / 3e-15 AT2G37030 103 / 2e-29 SAUR-like auxin-responsive protein family (.1) Potri.006G126500 [exp] 63 / 5e-14 AT2G37030 131 / 1e-40 SAUR-like auxin-responsive protein family (.1) Potri.008G037900 [exp] 62 / 2e-13 AT2G37030 103 / 2e-29 SAUR-like auxin-responsive protein family (.1) Potri.016G091500 [exp] 61 / 3e-13 AT2G37030 136 / 2e-42 SAUR-like auxin-responsive protein family (.1) Potri.002G024500 [exp] 54 / 3e-10 AT1G75590 194 / 1e-64 SAUR-like auxin-responsive protein family (.1) Potri.004G165800 [exp] 51 / 2e-09 AT4G34770 152 / 2e-49 SAUR-like auxin-responsive protein family (.1) Potri.009G126300 [exp] 49 / 7e-09 AT5G18060 123 / 2e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G164300 [exp] 50 / 1e-08 AT5G10990 170 / 3e-55 SAUR-like auxin-responsive protein family (.1) Potri.009G125900 [exp] 49 / 2e-08 AT5G10990 157 / 5e-50 SAUR-like auxin-responsive protein family (.1) Potri.009G126700 [exp] 48 / 2e-08 AT4G38840 126 / 3e-39 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10009219 pacid=23160154 polypeptide=Lus10009219 locus=Lus10009219.g ID=Lus10009219.BGIv1.0 annot-version=v1.0 ATGACGATGAGGTTGAAGAAGAAAGGTTGGCTAAAGATGCTGGCCAAGTACTTCAGAAGATCGAGCTGCATCCCTCAAGACGTGCCGAGAGGGCATATGG CGGTGTACGTCGGAGTAGGGGAATGGAAAAGATATGTGATAAAAGTTGGTTTGATAAACCATCCATTGTTCAAGACATTGCTTGATCAGCTGCTTATTGA TGATCATCATGATTACCCTCGTCAGGATTTCAGGCTACCTTCAACCCCTCTTCGCATTCCTTGCAGCGACTCCATTTTCTTAACCATTTTGAACTGCGCC CAACGGGACTTGTCGCATCGCTTTTGCTTCTGA
AA sequence Show only first row Show all	>Lus10009219 pacid=23160154 polypeptide=Lus10009219 locus=Lus10009219.g ID=Lus10009219.BGIv1.0 annot-version=v1.0 MTMRLKKKGWLKMLAKYFRRSSCIPQDVPRGHMAVYVGVGEWKRYVIKVGLINHPLFKTLLDQLLIDDHHDYPRQDFRLPSTPLRIPCSDSIFLTILNCA QRDLSHRFCF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G53250			SAUR-like auxin-responsive pro...		Lus10009219 [exp]	0	1
AT1G50420	GRAS	SCL-3, SCL3	scarecrow-like 3 (.1)		Lus10034374 [exp]	1.7	0.9513
AT1G24530			Transducin/WD40 repeat-like su...		Lus10036881 [exp]	2.2	0.9646
AT1G14185			Glucose-methanol-choline (GMC)...		Lus10030460 [exp]	3.2	0.9448
AT2G44990		MAX3, CCD7, ATC...	carotenoid cleavage dioxygenas...		Lus10021241 [exp]	5.3	0.9545
AT5G34940		ATGUS3	glucuronidase 3 (.1.2.3)		Lus10008038 [exp]	6.9	0.9286
AT5G20630		ATGER3, GLP3A, ...	GERMIN-LIKE PROTEIN 3, ARABIDO...		Lus10037663 [exp]	9.2	0.9282
AT4G05390		ATRFNR1	root FNR 1 (.1.2)		Lus10038538 [exp]	9.4	0.9459
AT3G22142			Bifunctional inhibitor/lipid-t...		Lus10010479 [exp]	9.5	0.9442
AT5G40850		UPM1	urophorphyrin methylase 1 (.1....		Lus10027819 [exp]	9.9	0.9070
AT5G17010			Major facilitator superfamily ...		Lus10009573 [exp]	10.5	0.9318

Compare expression of checked genes

Lus10009219 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.