Lus10009229 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G39000 320 / 4e-112 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.3)
AT4G28030 45 / 9e-06 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2)
AT5G16800 45 / 1e-05 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.3)
AT3G02980 44 / 3e-05 MCC1 MEIOTIC CONTROL OF CROSSOVERS1 (.1)
AT2G38130 42 / 8e-05 ATMAK3 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037996 435 / 4e-156 AT2G39000 335 / 2e-115 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.3)
Lus10023517 366 / 2e-129 AT2G39000 388 / 4e-137 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.3)
Lus10040401 362 / 5e-128 AT2G39000 386 / 3e-136 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.3)
Lus10019975 48 / 2e-06 AT4G28030 322 / 3e-111 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2)
Lus10041016 45 / 2e-05 AT5G16800 334 / 1e-116 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.3)
Lus10013457 44 / 3e-05 AT5G16800 337 / 1e-117 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.3)
Lus10021995 42 / 0.0002 AT1G72030 181 / 4e-56 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Lus10042534 41 / 0.0004 AT1G72030 179 / 3e-55 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Lus10041514 39 / 0.001 AT2G38130 287 / 3e-100 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G039300 353 / 7e-124 AT2G39000 387 / 1e-135 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.3)
Potri.010G222900 338 / 1e-118 AT2G39000 370 / 5e-130 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.3)
Potri.013G079900 48 / 2e-06 AT5G16800 346 / 3e-121 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.3)
Potri.006G176500 45 / 1e-05 AT4G28030 284 / 2e-96 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2)
Potri.019G050700 45 / 1e-05 AT5G16800 334 / 2e-116 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.3)
Potri.005G054600 44 / 3e-05 AT1G72030 216 / 1e-69 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Potri.011G139300 40 / 0.0004 AT2G38130 294 / 1e-102 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2)
Potri.001G429200 40 / 0.0006 AT2G38130 299 / 6e-105 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2)
Potri.001G435300 40 / 0.0006 AT2G38130 299 / 6e-105 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2)
Potri.001G432400 39 / 0.0007 AT2G38130 296 / 4e-104 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0257 Acetyltrans PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Representative CDS sequence
>Lus10009229 pacid=23160192 polypeptide=Lus10009229 locus=Lus10009229.g ID=Lus10009229.BGIv1.0 annot-version=v1.0
ATGGCGGAGTTGTTCCCATCATTGTCTCCAGAGATAGTGGTGAGAGAGGCTAGGATGGAGGACTTTTGGGAAGTGGCCGAGACTCATTGCAGCTCTTTCT
TCCCGAGATACGCATTCCCGCTTGATATTACTCTGAGACTGAATAGGCTAGTGGGGATGCTAGTTGGGTACTCTGTACCATCTGGTTGCAAGAGAATTTG
TCTGGTTGCTATTGTCGTTGATCAATCTTTTTACATTGGTAACGAGGGTATCAAGATTGGAGGATTTGATGCCAAGTTTACCATGAACAAGGGACATGTT
GCTGGGATACTGACCCTTGATACTGTAGCCAATTTCCTCCCGAGAAAAGGTCCACAAAAGCAAAGAAGGACTGGGATCGCATACATATCAAATGTAGCTG
TGCGTGAAAGATTTCGACGCAAGGGGATAGCTAAACAACTTGTTGTAAAGGCAGAGACATTGGCAAAAACTTGGGGGTGCCGCGCCATTGCTCTTCACTG
CGAGCTGCAGAATCCAGGTGCCACCCGACTGTACAGAGGGCAAGGTTTCAAGTGCATCAGGGTGCCCGACGGTGCAAACTGGCCTCATCCCAGAATCTCT
CCAGATGTTAAATTTAACTTCATGATGAAGCTTCTAAAACCCACAGCATCAACCATTATCACTTAG
AA sequence
>Lus10009229 pacid=23160192 polypeptide=Lus10009229 locus=Lus10009229.g ID=Lus10009229.BGIv1.0 annot-version=v1.0
MAELFPSLSPEIVVREARMEDFWEVAETHCSSFFPRYAFPLDITLRLNRLVGMLVGYSVPSGCKRICLVAIVVDQSFYIGNEGIKIGGFDAKFTMNKGHV
AGILTLDTVANFLPRKGPQKQRRTGIAYISNVAVRERFRRKGIAKQLVVKAETLAKTWGCRAIALHCELQNPGATRLYRGQGFKCIRVPDGANWPHPRIS
PDVKFNFMMKLLKPTASTIIT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G39000 Acyl-CoA N-acyltransferases (N... Lus10009229 0 1
AT5G47240 ATNUDT8 nudix hydrolase homolog 8 (.1) Lus10040169 2.0 0.9240
AT1G51110 Plastid-lipid associated prote... Lus10010444 6.2 0.9258
AT2G04700 ferredoxin thioredoxin reducta... Lus10039468 7.2 0.9231
AT4G34090 unknown protein Lus10041575 8.4 0.9080
AT1G31170 ATSRX sulfiredoxin (.1.2.3.4) Lus10036218 8.9 0.8925
AT2G30390 FC2, FC-II, ATF... ferrochelatase 2 (.1.2) Lus10019224 10.2 0.9010
AT1G74100 SOT16, ATSOT16,... CORONATINE INDUCED-7, ARABIDOP... Lus10033720 10.4 0.9012
AT4G22890 PGR5-LIKEA, PGR... PGR5-LIKE A (.1.2.3.4.5) Lus10006710 11.0 0.9236
AT4G40070 RING/U-box superfamily protein... Lus10034157 14.3 0.8967
AT5G06060 NAD(P)-binding Rossmann-fold s... Lus10001560 15.2 0.8922

Lus10009229 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.