Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G01940 291 / 2e-102 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G67530 155 / 1e-44 ATPUB49 plant U-box 49 (.1) AT3G44600 149 / 3e-42 AtCYP71, CYP71 cyclophilin 71, cyclophilin71 (.1) AT2G36130 137 / 2e-41 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT3G63400 117 / 1e-31 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1.2.3) AT5G13120 110 / 1e-29 Pnsl5, ATCYP20-2 Photosynthetic NDH subcomplex L 5, ARABIDOPSIS THALIANA CYCLOPHILIN 20-2, cyclophilin 20-2 (.1.2) AT4G34870 105 / 8e-29 ATCYP1, ROC5 ARABIDOPSIS THALIANA CYCLOPHILIN 1, rotamase cyclophilin 5 (.1) AT3G56070 103 / 4e-28 ROC2 rotamase cyclophilin 2 (.1.2) AT2G15790 106 / 1e-27 CYP40, SQN SQUINT, CYCLOPHILIN 40, peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase (.1) AT3G62030 102 / 6e-27 CYP20-3, ROC4 cyclophilin 20-3, rotamase CYP 4 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007794 [exp] 169 / 2e-49 AT5G67530 868 / 0.0 plant U-box 49 (.1) Lus10004731 [exp] 164 / 8e-48 AT5G67530 916 / 0.0 plant U-box 49 (.1) Lus10020573 [exp] 150 / 1e-42 AT3G44600 1115 / 0.0 cyclophilin 71, cyclophilin71 (.1) Lus10006271 [exp] 150 / 1e-42 AT3G44600 1110 / 0.0 cyclophilin 71, cyclophilin71 (.1) Lus10021335 [exp] 124 / 5e-36 AT2G36130 286 / 1e-100 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10024831 [exp] 130 / 3e-35 AT3G63400 308 / 8e-99 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1.2.3) Lus10018746 [exp] 130 / 4e-35 AT3G63400 306 / 4e-98 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1.2.3) Lus10017010 [exp] 120 / 2e-34 AT2G36130 278 / 4e-97 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10020992 [exp] 118 / 6e-32 AT2G15790 598 / 0.0 SQUINT, CYCLOPHILIN 40, peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G071600 [exp] 285 / 8e-100 AT1G01940 293 / 2e-103 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.002G149700 [exp] 285 / 2e-99 AT1G01940 293 / 3e-103 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.005G148900 [exp] 160 / 2e-46 AT5G67530 806 / 0.0 plant U-box 49 (.1) Potri.009G146400 [exp] 149 / 2e-42 AT3G44600 1095 / 0.0 cyclophilin 71, cyclophilin71 (.1) Potri.016G075600 [exp] 132 / 1e-39 AT2G36130 278 / 3e-97 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.009G106200 [exp] 122 / 3e-33 AT2G15790 561 / 0.0 SQUINT, CYCLOPHILIN 40, peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase (.1) Potri.004G144300 [exp] 114 / 1e-30 AT2G15790 590 / 0.0 SQUINT, CYCLOPHILIN 40, peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase (.1) Potri.007G040100 [exp] 112 / 6e-30 AT2G15790 551 / 0.0 SQUINT, CYCLOPHILIN 40, peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase (.1) Potri.002G185200 [exp] 110 / 1e-29 AT3G62030 293 / 2e-100 cyclophilin 20-3, rotamase CYP 4 (.1.2.3) Potri.005G135500 [exp] 110 / 3e-29 AT2G15790 553 / 0.0 SQUINT, CYCLOPHILIN 40, peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0475 [flax] [poplar] Cyclophil-like PF00160 [flax] [poplar] Pro_isomerase Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD
Representative CDS sequence Show only first row Show all	>Lus10009237 pacid=23160199 polypeptide=Lus10009237 locus=Lus10009237.g ID=Lus10009237.BGIv1.0 annot-version=v1.0 ATGGTCAGTACCTTTTTAGTTCTCATCAGAAATTTCGTGGTGTATTTCTTCTACTTTTCCAAACGAGCTCTTGAATTTTTTAATTTTGCTTCACAGTCGG TCACGCTGCACACCAATCTTGGGGATATCAAGTGTGAGATCTTCTGCGATGAGGTCCCCAAATCGGCCGAGAATTTCTTGGCACTATGCGCCAGTGGTTA TTACGATGGAACCATATTCCACCGGAATATCAAAGGTTTTATGATCCAAGGCGGAGATCCCACGGGTACAGGCAAAGGAGGAACTAGTATTTGGGGAAAG AAGTTCAATGATGAGATCAGAGAGTCTCTCAAGCATAACGCAAGGGGGATGCTGGCAATGGCTAACAGTGGGCCTAACACCAACGGAAGCCAGTTCTTCA TAATCTACGCGAAGCAGCCGCATCTCAACGGAGTGTATACCGTGTTTGGCAAAGTAATTCACGGGTTTGAGATTCTTGATATCATGGAAAAGACACCAAC AGGGCCGGGAGACAAACCCCTTGCCGAGATAAGGATCAACCACGTAACGATACATGCCAATCCACTTGCAGGCTAG
AA sequence Show only first row Show all	>Lus10009237 pacid=23160199 polypeptide=Lus10009237 locus=Lus10009237.g ID=Lus10009237.BGIv1.0 annot-version=v1.0 MVSTFLVLIRNFVVYFFYFSKRALEFFNFASQSVTLHTNLGDIKCEIFCDEVPKSAENFLALCASGYYDGTIFHRNIKGFMIQGGDPTGTGKGGTSIWGK KFNDEIRESLKHNARGMLAMANSGPNTNGSQFFIIYAKQPHLNGVYTVFGKVIHGFEILDIMEKTPTGPGDKPLAEIRINHVTIHANPLAG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G01940			Cyclophilin-like peptidyl-prol...		Lus10009237 [exp]	0	1
AT4G19150			Ankyrin repeat family protein ...		Lus10001048 [exp]	1.0	0.8700
AT2G17240			unknown protein		Lus10043214 [exp]	4.7	0.7927
AT2G37680		PAT3, FRY1, FHY...	unknown protein		Lus10023781 [exp]	6.3	0.8525
AT5G64680			unknown protein		Lus10011265 [exp]	6.5	0.8587
AT5G58005			Cytochrome c oxidase, subunit ...		Lus10036285 [exp]	7.6	0.7801
AT2G45520			unknown protein		Lus10015859 [exp]	7.9	0.8588
AT3G05870		APC11	anaphase-promoting complex/cyc...		Lus10015126 [exp]	10.7	0.8285
AT1G72175			RING/U-box protein with domain...		Lus10009529 [exp]	11.5	0.8146
AT3G01435			Expressed protein (.1)		Lus10003331 [exp]	13.5	0.8089
AT4G14965		ATMAPR4	membrane-associated progestero...		Lus10018026 [exp]	14.4	0.8182

Compare expression of checked genes

Lus10009237 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.