Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G03050 144 / 4e-41 RHD7, ATCSLD3, KJK, CSLD3 ROOT HAIR DEFECTIVE 7, KOJAK, CELLULOSE SYNTHASE LIKE D3, cellulose synthase-like D3 (.1) AT5G16910 135 / 4e-38 ATCSLD2 cellulose-synthase like D2 (.1) AT4G38190 100 / 2e-25 ATCSLD4 ARABIDOPSIS THALIANA CELLULOSE SYNTHASE-LIKE D4, cellulose synthase like D4 (.1) AT1G02730 56 / 5e-10 SOS6, ATCSLD5 SALT OVERLY SENSITIVE 6, CELLULOSE SYNTHASE LIKE D5, cellulose synthase-like D5 (.1) AT2G33100 51 / 2e-08 ATCSLD1 CELLULOSE-SYNTHASE LIKE D1, cellulose synthase-like D1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038008 [exp] 208 / 2e-63 AT3G03050 1818 / 0.0 ROOT HAIR DEFECTIVE 7, KOJAK, CELLULOSE SYNTHASE LIKE D3, cellulose synthase-like D3 (.1) Lus10026609 [exp] 168 / 1e-49 AT3G03050 1326 / 0.0 ROOT HAIR DEFECTIVE 7, KOJAK, CELLULOSE SYNTHASE LIKE D3, cellulose synthase-like D3 (.1) Lus10030454 [exp] 157 / 7e-49 AT3G03050 386 / 2e-126 ROOT HAIR DEFECTIVE 7, KOJAK, CELLULOSE SYNTHASE LIKE D3, cellulose synthase-like D3 (.1) Lus10026610 [exp] 166 / 1e-48 AT3G03050 1028 / 0.0 ROOT HAIR DEFECTIVE 7, KOJAK, CELLULOSE SYNTHASE LIKE D3, cellulose synthase-like D3 (.1) Lus10026568 [exp] 111 / 1e-29 AT4G38190 1868 / 0.0 ARABIDOPSIS THALIANA CELLULOSE SYNTHASE-LIKE D4, cellulose synthase like D4 (.1) Lus10013851 [exp] 111 / 1e-29 AT4G38190 1876 / 0.0 ARABIDOPSIS THALIANA CELLULOSE SYNTHASE-LIKE D4, cellulose synthase like D4 (.1) Lus10001619 [exp] 110 / 5e-29 AT4G38190 961 / 0.0 ARABIDOPSIS THALIANA CELLULOSE SYNTHASE-LIKE D4, cellulose synthase like D4 (.1) Lus10022982 [exp] 109 / 9e-29 AT4G38190 1823 / 0.0 ARABIDOPSIS THALIANA CELLULOSE SYNTHASE-LIKE D4, cellulose synthase like D4 (.1) Lus10009248 [exp] 105 / 1e-27 AT3G03050 1929 / 0.0 ROOT HAIR DEFECTIVE 7, KOJAK, CELLULOSE SYNTHASE LIKE D3, cellulose synthase-like D3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G082200 [exp] 178 / 4e-53 AT3G03050 1987 / 0.0 ROOT HAIR DEFECTIVE 7, KOJAK, CELLULOSE SYNTHASE LIKE D3, cellulose synthase-like D3 (.1) Potri.019G049700 [exp] 175 / 5e-52 AT3G03050 2020 / 0.0 ROOT HAIR DEFECTIVE 7, KOJAK, CELLULOSE SYNTHASE LIKE D3, cellulose synthase-like D3 (.1) Potri.009G170000 [exp] 107 / 4e-28 AT4G38190 1873 / 0.0 ARABIDOPSIS THALIANA CELLULOSE SYNTHASE-LIKE D4, cellulose synthase like D4 (.1) Potri.004G208800 [exp] 100 / 6e-26 AT4G38190 1835 / 0.0 ARABIDOPSIS THALIANA CELLULOSE SYNTHASE-LIKE D4, cellulose synthase like D4 (.1) Potri.003G097100 [exp] 83 / 1e-19 AT3G03050 1610 / 0.0 ROOT HAIR DEFECTIVE 7, KOJAK, CELLULOSE SYNTHASE LIKE D3, cellulose synthase-like D3 (.1) Potri.001G136200 [exp] 81 / 7e-19 AT3G03050 1640 / 0.0 ROOT HAIR DEFECTIVE 7, KOJAK, CELLULOSE SYNTHASE LIKE D3, cellulose synthase-like D3 (.1) Potri.014G125100 [exp] 73 / 3e-16 AT1G02730 1820 / 0.0 SALT OVERLY SENSITIVE 6, CELLULOSE SYNTHASE LIKE D5, cellulose synthase-like D5 (.1) Potri.002G200300 [exp] 69 / 1e-14 AT1G02730 1813 / 0.0 SALT OVERLY SENSITIVE 6, CELLULOSE SYNTHASE LIKE D5, cellulose synthase-like D5 (.1) Potri.003G177800 [exp] 50 / 7e-08 AT2G33100 1569 / 0.0 CELLULOSE-SYNTHASE LIKE D1, cellulose synthase-like D1 (.1) Potri.001G050200 [exp] 49 / 9e-08 AT2G33100 1576 / 0.0 CELLULOSE-SYNTHASE LIKE D1, cellulose synthase-like D1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10009247 pacid=23160182 polypeptide=Lus10009247 locus=Lus10009247.g ID=Lus10009247.BGIv1.0 annot-version=v1.0 ATGGCGTCGAAATCGTTCAAAGTGAGCAGCAGATCAAATCTGTCTATCAGTTCAGATGCAACGGACTCACAGAAGCCCCCACTCCCGCCGACGGTCACCT TCGGTAGGAGAACATCTTCCGCCCGGTACTCCAGGGACGACCTGGACAGTGAGATTGGCAGCGTCGACTTCATGAACTACACCGTCCACATCCCTCCGAC GCCGGACAACCAGCCTAGCACGGACCCTTCCATCTCCCAGAAGGTGGAGGAGCAGTACGTCTCCAGCTCCCTCTTCACCGGCGGCTTCAACAGCGTCACC CGCGGACATCTCATGGACAAGCCGGTACTCCAGGGACGACCTGGACAGTGA
AA sequence Show only first row Show all	>Lus10009247 pacid=23160182 polypeptide=Lus10009247 locus=Lus10009247.g ID=Lus10009247.BGIv1.0 annot-version=v1.0 MASKSFKVSSRSNLSISSDATDSQKPPLPPTVTFGRRTSSARYSRDDLDSEIGSVDFMNYTVHIPPTPDNQPSTDPSISQKVEEQYVSSSLFTGGFNSVT RGHLMDKPVLQGRPGQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G03050		RHD7, ATCSLD3, ...	ROOT HAIR DEFECTIVE 7, KOJAK, ...		Lus10009247 [exp]	0	1
AT3G03050		RHD7, ATCSLD3, ...	ROOT HAIR DEFECTIVE 7, KOJAK, ...		Lus10009248 [exp]	4.1	0.8891
AT1G30690			Sec14p-like phosphatidylinosit...		Lus10023378 [exp]	4.9	0.8568
AT3G03250		AtUGP1, UGP1, U...	UDP-GLUCOSE PYROPHOSPHORYLASE ...		Lus10031365 [exp]	6.3	0.8619
AT2G01270		ATQSOX2	quiescin-sulfhydryl oxidase 2 ...		Lus10035269 [exp]	7.7	0.8619
AT4G34450			coatomer gamma-2 subunit, puta...		Lus10026336 [exp]	9.2	0.8822
AT5G24710			Transducin/WD40 repeat-like su...		Lus10040564 [exp]	9.4	0.8665
AT1G71270		ATVPS52, TTD8, ...	T-DNA TRANSMISSION DEFECT 8, P...		Lus10016549 [exp]	14.7	0.8238
AT5G13390		NEF1	no exine formation 1 (.1)		Lus10002568 [exp]	14.8	0.8521
AT5G41950			Tetratricopeptide repeat (TPR)...		Lus10001675 [exp]	15.3	0.8670
AT1G26120		ICME-LIKE1	Isoprenylcysteine methylestera...		Lus10017889 [exp]	16.2	0.8287

Compare expression of checked genes

Lus10009247 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.