Plant FIBer expression Database

Lus10009250 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G24460 81 / 1e-18 TNO1 TGN-localized SYP41 interacting protein, unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006252
[exp]
0 / 1 AT1G24460 937 / 0.0 TGN-localized SYP41 interacting protein, unknown protein
Lus10036938
[exp]
0 / 1 AT1G24460 838 / 0.0 TGN-localized SYP41 interacting protein, unknown protein
Lus10011394
[exp]
0 / 1 AT1G24460 415 / 3e-126 TGN-localized SYP41 interacting protein, unknown protein
Lus10006450
[exp]
0 / 1 AT1G24460 902 / 0.0 TGN-localized SYP41 interacting protein, unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G052600
[exp]
80 / 3e-18 AT1G24460 1116 / 0.0 TGN-localized SYP41 interacting protein, unknown protein
PFAM info
Representative CDS sequence
>Lus10009250 pacid=23160173 polypeptide=Lus10009250 locus=Lus10009250.g ID=Lus10009250.BGIv1.0 annot-version=v1.0
ATGGGCTTTTGCCGCTGTTGGAAAAGCAGGTTAAGGCATTGTTCTCGGACGTTGAAACTGCAAAGTCACAAGCTCAGGAGCTTGGTAACAGGTTGCTTGA
GAGCCAGAAGGTTGTGGTTGAAGATTCTGATAGAAGTAGAAGTGCAGCACAAACTGAGATTTTCCAGGAAAGGAGTATGTTTAAAAGCTCCATCTCCACC
GAGTGGCTCGGAGATATCCGAAGCTGAAGATGCTGGCTCCATCGGGAAGAACCCTCCAGCTCCAGTCCCGAAAGCTGCTCATGTAAGAACGACACAAAAG
GGAGGATCGAGCGACCATCTCGCAATCAGCATCGACTCAGAATCCGCCACACTCATCAACAAGGATGAAACTGACGAGGACAAAGGTTTGCATCGCAATG
ATGCCTTTTCTCACTAG
AA sequence
>Lus10009250 pacid=23160173 polypeptide=Lus10009250 locus=Lus10009250.g ID=Lus10009250.BGIv1.0 annot-version=v1.0
MGFCRCWKSRLRHCSRTLKLQSHKLRSLVTGCLRARRLWLKILIEVEVQHKLRFSRKGVCLKAPSPPSGSEISEAEDAGSIGKNPPAPVPKAAHVRTTQK
GGSSDHLAISIDSESATLINKDETDEDKGLHRNDAFSH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G24460 TNO1 TGN-localized SYP41 interactin... Lus10009250
[exp]
0 1
AT3G10460 Plant self-incompatibility pro... Lus10016165
[exp]
1.0 1.0000
Lus10020192
[exp]
2.0 0.9182
AT5G03860 MLS malate synthase (.1.2) Lus10006282
[exp]
2.8 0.8398
AT4G23180 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-li... Lus10015092
[exp]
6.5 0.8843
AT5G59845 Gibberellin-regulated family p... Lus10018708
[exp]
9.4 0.7135
AT5G28210 mRNA capping enzyme family pro... Lus10040496
[exp]
11.2 0.8038
AT1G64090 RTNLB3 Reticulan like protein B3 (.1.... Lus10013099
[exp]
13.5 0.6945
AT3G53180 NodGS nodulin/glutamine synthase-lik... Lus10023904
[exp]
13.6 0.7802
AT4G11530 CRK34 cysteine-rich RLK (RECEPTOR-li... Lus10022285
[exp]
14.7 0.7802
Lus10010383
[exp]
15.7 0.7802

Lus10009250 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.