Lus10009252 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G09990 258 / 4e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1)
AT5G18380 258 / 5e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1.2.3)
AT3G04230 243 / 5e-84 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038012 306 / 9e-109 AT2G09990 258 / 5e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Lus10035133 290 / 1e-102 AT2G09990 258 / 4e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Lus10031970 290 / 1e-102 AT2G09990 258 / 4e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Lus10034378 288 / 7e-102 AT5G18380 261 / 4e-91 Ribosomal protein S5 domain 2-like superfamily protein (.1.2.3)
Lus10012599 286 / 4e-101 AT5G18380 261 / 4e-91 Ribosomal protein S5 domain 2-like superfamily protein (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G304700 274 / 3e-96 AT2G09990 267 / 9e-94 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Potri.008G150000 273 / 4e-96 AT2G09990 262 / 1e-91 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Potri.010G091000 272 / 1e-95 AT2G09990 260 / 7e-91 Ribosomal protein S5 domain 2-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0329 S5 PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Representative CDS sequence
>Lus10009252 pacid=23160198 polypeptide=Lus10009252 locus=Lus10009252.g ID=Lus10009252.BGIv1.0 annot-version=v1.0
ATGGCGGCGCCGGCAGCAACAGGAGCATCGCCGATCGAGTCAGTCCAGTGCTTCGGCCGCAAGAAGACCGCGGTGGCCGTCACCCACTGCAAGAGAGGAA
GAGGCCTGATCAAGCTCAACGGTACTCCCATCGAGCTCGTGGAGCCCGAGATCCTCCGCTTCAAGGCCGTGGAGCCGATCCTTCTCCTCGGACGTCAGCG
CTTCAGCGGCGTCGACATGAGGATCCGCGTCAAGGGAGGAGGGCACACTTCCCAGATCTACGCCATTCGTCAGAGCATCGCCAAGGCGCTTGTAGCTTTC
TACCAGAAGTTCGTCGACGAGCAGAGCAAGAAGGAGATCAAAGACCTTCTCATCAGGTACGACAGGACTCTTCTGGTCGCTGATCCGAGGCGTTGCGAGC
CTAAGAAGTTCGGTGGTCGTGGTGCCCGTTCCAGGTTCCAGAAGAGTTACCGTTGA
AA sequence
>Lus10009252 pacid=23160198 polypeptide=Lus10009252 locus=Lus10009252.g ID=Lus10009252.BGIv1.0 annot-version=v1.0
MAAPAATGASPIESVQCFGRKKTAVAVTHCKRGRGLIKLNGTPIELVEPEILRFKAVEPILLLGRQRFSGVDMRIRVKGGGHTSQIYAIRQSIAKALVAF
YQKFVDEQSKKEIKDLLIRYDRTLLVADPRRCEPKKFGGRGARSRFQKSYR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G09990 Ribosomal protein S5 domain 2-... Lus10009252 0 1
AT3G10950 Zinc-binding ribosomal protein... Lus10006414 4.8 0.8292
AT5G56940 Ribosomal protein S16 family p... Lus10014281 5.5 0.7873
AT1G77940 Ribosomal protein L7Ae/L30e/S1... Lus10027926 8.0 0.8157
AT3G22660 rRNA processing protein-relate... Lus10031120 9.3 0.8107
AT5G02960 Ribosomal protein S12/S23 fami... Lus10023172 10.5 0.8019
AT2G31610 Ribosomal protein S3 family pr... Lus10033442 10.8 0.8101
AT5G20920 EIF2 BETA, EMB1... embryo defective 1401, eukaryo... Lus10012186 14.1 0.7675
AT3G10090 Nucleic acid-binding, OB-fold-... Lus10029320 14.1 0.7902
AT3G11510 Ribosomal protein S11 family p... Lus10014220 16.5 0.7991
AT3G16780 Ribosomal protein L19e family ... Lus10023388 16.6 0.7834

Lus10009252 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.