Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G01660 78 / 2e-18 ATABC1, ATATH10, ABC1At ABC transporter 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038017 [exp] 160 / 4e-48 AT4G01660 772 / 0.0 ABC transporter 1 (.1) Lus10010085 [exp] 117 / 2e-32 AT4G01660 780 / 0.0 ABC transporter 1 (.1) Lus10007201 [exp] 115 / 1e-31 AT4G01660 778 / 0.0 ABC transporter 1 (.1) Lus10007202 [exp] 72 / 1e-18 AT4G01660 62 / 6e-13 ABC transporter 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G185400 [exp] 97 / 3e-25 AT4G01660 691 / 0.0 ABC transporter 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10009257 pacid=23160188 polypeptide=Lus10009257 locus=Lus10009257.g ID=Lus10009257.BGIv1.0 annot-version=v1.0 ATGAGTTCCTCGTTCAAGCACGTAAGCAGGCTCCTCGAAGGCGTCTCTCTGGTCGCCAAGGAGATCGTAAAGCGCTCTTCCCCTCCATTGGACGCCGCCT CCTCCAAGGCAGACTTCGAATCCCTAATCGCATCCACCGCCAGAAAGGCATTGCTCGCCGCTACCGACTTGTCCGGTCTCACCAGAGGGAAACAACGCGA GTTCTCCGCTCCTCGGCCTAAGGAGTCCGTCGTTTACTTCGACCGATGA
AA sequence Show only first row Show all	>Lus10009257 pacid=23160188 polypeptide=Lus10009257 locus=Lus10009257.g ID=Lus10009257.BGIv1.0 annot-version=v1.0 MSSSFKHVSRLLEGVSLVAKEIVKRSSPPLDAASSKADFESLIASTARKALLAATDLSGLTRGKQREFSAPRPKESVVYFDR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G01660		ATABC1, ATATH10...	ABC transporter 1 (.1)		Lus10009257 [exp]	0	1
AT3G51770		ATEOL1, ETO1	ARABIDOPSIS ETHYLENE OVERPRODU...		Lus10012472 [exp]	3.9	0.7874
AT1G48840			Plant protein of unknown funct...		Lus10026581 [exp]	24.5	0.7077
AT2G25660		EMB2410	embryo defective 2410 (.1)		Lus10022111 [exp]	26.5	0.7012
AT4G22200		AKT3, AKT2/3	potassium transport 2/3 (.1)		Lus10015474 [exp]	59.9	0.6740
AT5G32440			Ubiquitin system component Cue...		Lus10027699 [exp]	64.6	0.6238
AT1G69080			Adenine nucleotide alpha hydro...		Lus10036814 [exp]	171.5	0.6217
AT5G16940			carbon-sulfur lyases (.1.2)		Lus10018517 [exp]	203.6	0.6132
AT2G43040		NPG1	no pollen germination 1, tetra...		Lus10033595 [exp]	208.3	0.5916
					Lus10026028 [exp]	223.1	0.6037

Compare expression of checked genes

Lus10009257 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.