Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G13600 70 / 7e-16 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G26630 41 / 1e-05 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G61170 38 / 0.0002 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G18840 37 / 0.0004 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT3G12770 36 / 0.0007 MEF22 mitochondrial editing factor 22 (.1) AT3G22690 36 / 0.0007 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015898 [exp] 122 / 3e-34 AT2G13600 899 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10009437 [exp] 40 / 2e-05 AT1G71420 753 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10018945 [exp] 40 / 4e-05 AT1G21400 644 / 0.0 Thiamin diphosphate-binding fold (THDP-binding) superfamily protein (.1) Lus10036921 [exp] 39 / 6e-05 AT4G37170 806 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10018978 [exp] 38 / 0.0001 AT4G13650 1258 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10033858 [exp] 37 / 0.0002 AT1G08070 422 / 4e-139 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10038839 [exp] 37 / 0.0002 AT5G13230 715 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10003383 [exp] 37 / 0.0003 AT2G21090 145 / 1e-40 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10022890 [exp] 37 / 0.0003 AT3G61170 865 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G104700 [exp] 70 / 6e-16 AT2G13600 834 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.012G018800 [exp] 40 / 2e-05 AT2G13600 463 / 3e-152 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.004G047800 [exp] 39 / 5e-05 AT4G13650 654 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.009G027400 [exp] 39 / 7e-05 AT4G13650 408 / 8e-128 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.013G145000 [exp] 37 / 0.0002 AT1G03540 721 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.002G220600 [exp] 37 / 0.0002 AT3G26630 481 / 2e-167 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.008G121400 [exp] 37 / 0.0002 AT1G13410 561 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.004G071800 [exp] 37 / 0.0004 AT5G52850 803 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.013G058900 [exp] 36 / 0.0005 AT4G13650 1282 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.017G091600 [exp] 36 / 0.0006 AT4G37170 924 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10009268 pacid=23141860 polypeptide=Lus10009268 locus=Lus10009268.g ID=Lus10009268.BGIv1.0 annot-version=v1.0 ATGGCAAGACTCTCTATTCCTGCTAAACGTGCCATTAGCGACGTTGCTTACCTCGACTCCTCACCTTTTGCTAAGCTTTTGGATTCTTGTGTCGCATCTA AGTCTGCCAAAGATACCTTCGGTGTTCATGCCCGTATCATCAAATCCGGGTTTGCATCTGAAGTCTTTATCCAGAACAGACTCATTGATGCGTATGGATA G
AA sequence Show only first row Show all	>Lus10009268 pacid=23141860 polypeptide=Lus10009268 locus=Lus10009268.g ID=Lus10009268.BGIv1.0 annot-version=v1.0 MARLSIPAKRAISDVAYLDSSPFAKLLDSCVASKSAKDTFGVHARIIKSGFASEVFIQNRLIDAYG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G13600			Pentatricopeptide repeat (PPR)...		Lus10009268 [exp]	0	1
AT1G68710			ATPase E1-E2 type family prote...		Lus10034403 [exp]	14.7	0.6099
AT5G22290	NAC	FSQ6, FAN, ANAC...	fructose-sensing quantitative ...		Lus10043402 [exp]	15.0	0.6032
AT3G09320			DHHC-type zinc finger family p...		Lus10024377 [exp]	27.2	0.5841
AT5G36210			alpha/beta-Hydrolases superfam...		Lus10032765 [exp]	46.0	0.5103
AT4G16150	CAMTA		calmodulin binding;transcripti...		Lus10037738 [exp]	77.4	0.5362
AT5G05570			transducin family protein / WD...		Lus10030399 [exp]	121.1	0.5036
AT1G34630			unknown protein		Lus10043395 [exp]	167.6	0.4722
AT4G24690		AtNBR1	Arabidopsis thaliana next to B...		Lus10043320 [exp]	201.8	0.4596
AT2G42080			Chaperone DnaJ-domain superfam...		Lus10029287 [exp]	203.6	0.4466
					Lus10013743 [exp]	222.9	0.4382

Compare expression of checked genes

Lus10009268 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.