Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G09740 227 / 5e-77 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G11930 130 / 2e-38 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT3G58450 114 / 5e-32 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT2G47710 101 / 1e-27 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G62550 100 / 6e-27 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G68300 85 / 3e-21 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G11360 75 / 1e-16 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT3G17020 70 / 2e-15 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G03270 68 / 9e-15 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT5G14680 69 / 1e-14 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015896 [exp] 284 / 3e-99 AT1G09740 185 / 3e-60 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029850 [exp] 115 / 4e-32 AT3G62550 140 / 5e-42 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029849 [exp] 120 / 1e-31 AT2G47430 489 / 2e-153 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1) Lus10041436 [exp] 107 / 5e-30 AT1G68300 159 / 2e-50 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029310 [exp] 106 / 7e-29 AT3G11930 197 / 2e-64 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Lus10034337 [exp] 104 / 1e-28 AT1G68300 164 / 2e-52 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10006701 [exp] 98 / 5e-26 AT2G47710 218 / 1e-73 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10007043 [exp] 96 / 3e-25 AT2G47710 214 / 2e-72 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10025033 [exp] 83 / 6e-20 AT3G62550 186 / 1e-60 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G104700 [exp] 282 / 2e-98 AT1G09740 251 / 2e-86 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.005G157100 [exp] 144 / 6e-45 AT1G09740 127 / 2e-38 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.016G064000 [exp] 121 / 7e-35 AT3G11930 214 / 4e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.006G198200 [exp] 117 / 4e-33 AT3G11930 209 / 9e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.010G123200 [exp] 112 / 8e-32 AT1G68300 173 / 5e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.008G121900 [exp] 111 / 2e-31 AT1G68300 188 / 5e-62 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.013G009800 [exp] 111 / 3e-31 AT3G62550 172 / 2e-55 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.014G130100 [exp] 103 / 3e-28 AT2G47710 234 / 4e-80 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.002G205275 [exp] 102 / 8e-28 AT2G47710 226 / 6e-77 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.002G193800 [exp] 100 / 4e-27 AT2G47710 213 / 1e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0039 [flax] [poplar] HUP PF00582 [flax] [poplar] Usp Universal stress protein family
Representative CDS sequence Show only first row Show all	>Lus10009272 pacid=23141866 polypeptide=Lus10009272 locus=Lus10009272.g ID=Lus10009272.BGIv1.0 annot-version=v1.0 ATGTCTTCGACTTCCAACATCGGTTGTGCCGTCGTCGCCGTAGACGGCAGCGAGGAGAGTATGTATGCCTTGCGGTGGGCGCTTGACAGCGTCAACCTCC GATCTCCTCCTGCCAACTCTACCGAATTGCCTGGATCATTCGTCGTCCTCCACGTCCAATCGCCACCGTCAATCGCCGTAGGCCTCAATCCTGGCGCCAT CCCCTTCGGTGGTCCAAGTGATCTGGAGGTTCCAGCTTTCACCGCGGCGATTGAGGCTCACCAGAAACGGATTACAGAGGCGATCTTTGATCACGCCTTG GAGATTTGCCGCAAAAAGAAGCTTACTGCTGTGAGAACGCAAGTCGTGATCGGGGACCCCAAAGAGAAGATATGTGAAATTGTAGAGAGTCTTCATGCTG ATTTGTTGGTGATGGGCTCCCGAGACTTTGGTCCTATTAAAAGGATGTTTCTGGGAAGTGTAAGCAACTATTGTGCAAACCATGCTCAATGTCCTGTCAT TATAATTAAGGGCAAAGGCGAGAACAAGAACACTTCCTCGTAG
AA sequence Show only first row Show all	>Lus10009272 pacid=23141866 polypeptide=Lus10009272 locus=Lus10009272.g ID=Lus10009272.BGIv1.0 annot-version=v1.0 MSSTSNIGCAVVAVDGSEESMYALRWALDSVNLRSPPANSTELPGSFVVLHVQSPPSIAVGLNPGAIPFGGPSDLEVPAFTAAIEAHQKRITEAIFDHAL EICRKKKLTAVRTQVVIGDPKEKICEIVESLHADLLVMGSRDFGPIKRMFLGSVSNYCANHAQCPVIIIKGKGENKNTSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G09740			Adenine nucleotide alpha hydro...		Lus10009272 [exp]	0	1
AT4G14410	bHLH	bHLH104	basic Helix-Loop-Helix 104, ba...		Lus10021199 [exp]	8.0	0.7902
AT1G22440			Zinc-binding alcohol dehydroge...		Lus10005650 [exp]	15.3	0.7573
AT3G22800			Leucine-rich repeat (LRR) fami...		Lus10006611 [exp]	39.7	0.7903
AT4G34770			SAUR-like auxin-responsive pro...		Lus10012183 [exp]	50.8	0.7876
AT4G11280		ATACS6, ACS6	1-aminocyclopropane-1-carboxyl...		Lus10017521 [exp]	54.7	0.7499
AT3G19850			Phototropic-responsive NPH3 fa...		Lus10034200 [exp]	79.7	0.7559
AT5G23550			Got1/Sft2-like vescicle transp...		Lus10039619 [exp]	87.3	0.7550
AT3G52970		CYP76G1	"cytochrome P450, family 76, s...		Lus10021136 [exp]	93.0	0.7423
AT1G09480			NAD(P)-binding Rossmann-fold s...		Lus10016389 [exp]	135.2	0.7496
AT4G18550		AtDSEL	Arabidopsis thaliana DAD1-like...		Lus10013936 [exp]	141.7	0.7419

Compare expression of checked genes

Lus10009272 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.