Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G00165 131 / 3e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G45180 100 / 7e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G62510 96 / 5e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G46890 92 / 5e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12490 94 / 6e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G46900 91 / 1e-24 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12470 91 / 7e-24 AZI1 azelaic acid induced 1 (.1) AT1G12100 89 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12510 89 / 2e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12520 89 / 2e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015883 [exp] 216 / 8e-74 AT4G00165 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10032253 [exp] 100 / 7e-28 ND 139 / 2e-43 Lus10032254 [exp] 100 / 9e-28 AT4G12520 139 / 3e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024627 [exp] 100 / 1e-27 AT4G12520 136 / 3e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024615 [exp] 100 / 2e-27 ND 139 / 6e-43 Lus10032263 [exp] 99 / 2e-27 AT4G12520 135 / 9e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10001493 [exp] 99 / 2e-27 AT1G62510 111 / 2e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024616 [exp] 99 / 2e-27 AT4G12520 139 / 2e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10028929 [exp] 96 / 4e-26 AT4G12520 147 / 9e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G059800 [exp] 128 / 5e-39 AT4G00165 127 / 1e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.013G128800 [exp] 106 / 2e-30 AT4G12480 109 / 5e-31 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.018G025900 [exp] 103 / 3e-29 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G158400 [exp] 100 / 3e-28 AT1G62510 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121800 [exp] 98 / 3e-27 AT1G12100 143 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121900 [exp] 97 / 1e-26 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G111400 [exp] 96 / 3e-26 AT1G62510 93 / 7e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G256100 [exp] 93 / 4e-25 AT2G45180 116 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G122100 [exp] 92 / 2e-23 AT4G12480 96 / 7e-24 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G200100 [exp] 77 / 2e-19 AT4G12470 69 / 8e-16 azelaic acid induced 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10009282 pacid=23141870 polypeptide=Lus10009282 locus=Lus10009282.g ID=Lus10009282.BGIv1.0 annot-version=v1.0 ATGGCGGGTTCCAAGGCAACCACCGTAGCTCTTCTTCTTCTTGCTCTGTTTCTAACCTCTGTTTCGTCTCACGGAGTACCACCACCATGCCAACCAGCAA AACCAAAGCACACACTACCGGCGATACCTCCACCGAAGCCGACCACCTCCGACAAGTGCCCCAGGGATGTCCTGAAGTTCGGGGTTTGCGGGAGCTGGTT GGGTTTGGCGTACGAGGTTGTGGGGACTAAACCCAGCGAGGAATGCTGCACAGTCATCAAAGGGATTGTAGATCTGGAAGCAGCTATGTGTCTGTGCACT GCAATCAAAGCTAATGTTCTGGGAATGGTGAAGCTGGACATCCCCATCGCTGCTACTCTGCTCGTCAATGCCTGTGGTGGCGATATCCCTCAAGGATTTA AGTGCGCTTGA
AA sequence Show only first row Show all	>Lus10009282 pacid=23141870 polypeptide=Lus10009282 locus=Lus10009282.g ID=Lus10009282.BGIv1.0 annot-version=v1.0 MAGSKATTVALLLLALFLTSVSSHGVPPPCQPAKPKHTLPAIPPPKPTTSDKCPRDVLKFGVCGSWLGLAYEVVGTKPSEECCTVIKGIVDLEAAMCLCT AIKANVLGMVKLDIPIAATLLVNACGGDIPQGFKCA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G00165			Bifunctional inhibitor/lipid-t...		Lus10009282 [exp]	0	1
AT4G00165			Bifunctional inhibitor/lipid-t...		Lus10015883 [exp]	1.0	0.9556
AT4G15620			Uncharacterised protein family...		Lus10041528 [exp]	1.4	0.9526
AT1G63260		TET10	tetraspanin10 (.1.2.3)		Lus10029562 [exp]	3.5	0.9166
AT3G07130		ATPAP15, PAP15	purple acid phosphatase 15 (.1...		Lus10016665 [exp]	3.6	0.8958
AT2G40435			unknown protein		Lus10017415 [exp]	4.0	0.9051
					Lus10019515 [exp]	4.2	0.9038
AT3G57930			unknown protein		Lus10031806 [exp]	4.5	0.9150
AT1G23000			Heavy metal transport/detoxifi...		Lus10028529 [exp]	5.6	0.8681
AT4G38380			MATE efflux family protein (.1...		Lus10020203 [exp]	5.7	0.8990
AT2G27385			Pollen Ole e 1 allergen and ex...		Lus10020642 [exp]	6.9	0.9091

Compare expression of checked genes

Lus10009282 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.