Lus10009286 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G60690 129 / 3e-38 SAUR-like auxin-responsive protein family (.1)
AT2G45210 121 / 3e-35 SAUR-like auxin-responsive protein family (.1)
AT4G12410 95 / 5e-25 SAUR-like auxin-responsive protein family (.1)
AT4G22620 94 / 9e-25 SAUR-like auxin-responsive protein family (.1)
AT2G46690 78 / 6e-19 SAUR-like auxin-responsive protein family (.1)
AT4G00880 76 / 4e-18 SAUR-like auxin-responsive protein family (.1)
AT5G53590 76 / 9e-18 SAUR-like auxin-responsive protein family (.1)
AT3G61900 74 / 3e-17 SAUR-like auxin-responsive protein family (.1)
AT3G03850 72 / 8e-17 SAUR-like auxin-responsive protein family (.1)
AT2G21210 71 / 2e-16 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015879 273 / 1e-94 AT3G60690 151 / 7e-47 SAUR-like auxin-responsive protein family (.1)
Lus10030295 133 / 5e-40 AT2G45210 131 / 1e-39 SAUR-like auxin-responsive protein family (.1)
Lus10024600 94 / 2e-24 AT4G12410 149 / 3e-46 SAUR-like auxin-responsive protein family (.1)
Lus10032237 90 / 7e-23 AT4G12410 149 / 2e-46 SAUR-like auxin-responsive protein family (.1)
Lus10004337 88 / 3e-22 AT4G12410 110 / 2e-31 SAUR-like auxin-responsive protein family (.1)
Lus10028920 85 / 8e-22 AT4G12410 106 / 1e-30 SAUR-like auxin-responsive protein family (.1)
Lus10001985 82 / 4e-20 AT2G45210 93 / 2e-24 SAUR-like auxin-responsive protein family (.1)
Lus10010110 71 / 4e-16 AT2G46690 124 / 1e-37 SAUR-like auxin-responsive protein family (.1)
Lus10034507 70 / 3e-15 AT1G75590 189 / 1e-62 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G145300 179 / 1e-57 AT3G60690 174 / 4e-56 SAUR-like auxin-responsive protein family (.1)
Potri.014G066900 175 / 3e-56 AT3G60690 191 / 9e-63 SAUR-like auxin-responsive protein family (.1)
Potri.003G113100 108 / 7e-30 AT4G12410 149 / 1e-46 SAUR-like auxin-responsive protein family (.1)
Potri.001G119900 98 / 4e-26 AT4G12410 140 / 8e-43 SAUR-like auxin-responsive protein family (.1)
Potri.014G103300 77 / 1e-18 AT2G46690 152 / 2e-49 SAUR-like auxin-responsive protein family (.1)
Potri.002G176400 77 / 1e-18 AT2G46690 145 / 2e-46 SAUR-like auxin-responsive protein family (.1)
Potri.012G023400 77 / 2e-18 AT2G46690 125 / 4e-38 SAUR-like auxin-responsive protein family (.1)
Potri.015G006800 73 / 7e-17 AT2G46690 128 / 2e-39 SAUR-like auxin-responsive protein family (.1)
Potri.009G127400 70 / 9e-16 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1)
Potri.009G127500 69 / 1e-15 AT2G21210 128 / 5e-40 SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10009286 pacid=23141880 polypeptide=Lus10009286 locus=Lus10009286.g ID=Lus10009286.BGIv1.0 annot-version=v1.0
ATGAGAAGAATCAAGGGATTCAAGTTACGAAAGCGGTTTCTTCGCGTAGCAAGTTGGATCTTCACCCGCAGACGGAGAAACCGCTCTCTCTACAATCGGT
TAATGTCCGGCGACGACGTTTCAACGTCGTCGTCGAGATCCAAGACGATTAGGAGAATCATGGACTGGGGCCGCCGAGTGCCCACCGGTGCCAAATCGCT
CTGCTCCGCCAAACCGGGTAATTACATCCGTGTCGAAGAACAGAAGGAGCCGCTCTGCCAGAAAGCGGCCGCCGTGCCCAAGGGGCATCTGGCGGTTTAC
GTGGGCGAAAAGGATGGCGGCGGCGGGGGTTGCCACAGAGTGTTCGTGCCGGTGATTTACGTAAACCATCCCCTGTTCGGCGATCTGCTGAGGGAGGCGG
AGCAGGAGTACGGGTTCAGCCAGGAAGGCGGGATAACGATTCCTTGTCCTTTCGCTGAGTTTGAACGGGTTAAGACGCGGATCGATGCCGGGTCTTGCGG
CGGCCGGCGGCTGCATACGTGGAAACGAAATCACTATTGA
AA sequence
>Lus10009286 pacid=23141880 polypeptide=Lus10009286 locus=Lus10009286.g ID=Lus10009286.BGIv1.0 annot-version=v1.0
MRRIKGFKLRKRFLRVASWIFTRRRRNRSLYNRLMSGDDVSTSSSRSKTIRRIMDWGRRVPTGAKSLCSAKPGNYIRVEEQKEPLCQKAAAVPKGHLAVY
VGEKDGGGGGCHRVFVPVIYVNHPLFGDLLREAEQEYGFSQEGGITIPCPFAEFERVKTRIDAGSCGGRRLHTWKRNHY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G60690 SAUR-like auxin-responsive pro... Lus10009286 0 1
AT3G60690 SAUR-like auxin-responsive pro... Lus10015879 1.4 0.9355
AT1G61930 Protein of unknown function, D... Lus10020047 2.2 0.9411
AT5G60900 RLK1 receptor-like protein kinase 1... Lus10031230 4.5 0.8991
AT4G38225 unknown protein Lus10013843 4.6 0.9282
AT3G22550 Protein of unknown function (D... Lus10010568 5.7 0.8942
Lus10040811 7.7 0.9148
AT5G40382 Cytochrome c oxidase subunit V... Lus10008765 7.7 0.8796
AT5G53730 Late embryogenesis abundant (L... Lus10032932 8.0 0.9026
AT2G42610 LSH10 LIGHT SENSITIVE HYPOCOTYLS 10,... Lus10007272 8.8 0.8928
AT3G58070 C2H2ZnF GIS GLABROUS INFLORESCENCE STEMS, ... Lus10016238 9.2 0.9118

Lus10009286 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.