Lus10009287 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G60730 317 / 4e-106 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT1G23200 254 / 2e-81 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT1G11580 243 / 3e-77 ATPMEPCRA methylesterase PCR A (.1)
AT5G51490 243 / 3e-77 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT5G51500 240 / 4e-76 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT2G45220 237 / 2e-75 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT4G02330 238 / 5e-75 AtPME41, ATPMEPCRB pectin methylesterase 41, Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT2G47550 236 / 1e-74 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT1G02810 236 / 3e-74 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT3G10720 236 / 5e-74 Plant invertase/pectin methylesterase inhibitor superfamily (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015877 441 / 2e-155 AT3G60730 535 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10009110 254 / 1e-81 AT1G23200 501 / 1e-173 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10013344 249 / 1e-79 AT3G14310 698 / 0.0 pectin methylesterase 3 (.1)
Lus10006103 244 / 2e-78 AT2G45220 592 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10039314 246 / 4e-78 AT3G14310 702 / 0.0 pectin methylesterase 3 (.1)
Lus10038917 244 / 8e-78 AT2G45220 630 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10027202 236 / 2e-74 AT2G45220 620 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10008203 234 / 6e-74 AT4G02320 497 / 2e-172 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10027206 233 / 6e-74 AT2G45220 551 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G145700 281 / 5e-94 AT3G60730 447 / 3e-155 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.010G109400 270 / 1e-87 AT1G23200 579 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.012G126800 263 / 2e-85 AT2G45220 637 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.015G127700 262 / 6e-85 AT2G45220 680 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.014G067100 249 / 4e-80 AT2G45220 691 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.011G025400 246 / 2e-78 AT1G11580 638 / 0.0 methylesterase PCR A (.1)
Potri.015G127800 245 / 2e-78 AT3G47400 649 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.001G162400 244 / 2e-77 AT3G14310 792 / 0.0 pectin methylesterase 3 (.1)
Potri.003G072800 243 / 5e-77 AT3G14310 795 / 0.0 pectin methylesterase 3 (.1)
Potri.002G145500 241 / 8e-77 AT2G45220 670 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0268 Pec_lyase-like PF01095 Pectinesterase Pectinesterase
Representative CDS sequence
>Lus10009287 pacid=23141900 polypeptide=Lus10009287 locus=Lus10009287.g ID=Lus10009287.BGIv1.0 annot-version=v1.0
ATGGCACCTCAAGCTAACATCAGTAGTAATGTGGGACTCCTAATGTCATGGACATCCGCAACCTCCAAGGCCAACTTCGTAGTTGCCAAAGACGGTTCCG
GCACACACAGATCCGTAAACGACGCCGTGGAGGCAGCAGCATCAGGAAGAAGAACCTCAGCGGAGAGAGTGGTTATACACGTGAAAGCGGGAGTTTACAA
TGAGAGAGTAGAGATCCCTCTCCACTTGAAGAATCTCATGTTGGTCGGCGACGACATTGATCGAACTGTCATCACCGGTAGCCGGAATATCCCCGATGGC
TCCACCACCTATAACTCCGCCACCTTCGGTAATTTGTGTTTCGGGAGACCGCTTTTGGGCGAGGGACATCACGTCGAGAACACTGCCGCCCCACAGAAGC
ACCAGGCGGTAGCGCTCCGAGTGAACTCCGATCAGGCGTTTTTCTACCGATGTAGCTTCAGAGGATATCATGACACTCTGTTCGTACATTCCCTCCGCCA
ATTCTACGGCGACTGCCATATCTACGGCACAATCGATTTCATCTTCGGGGACGCCTCCGCCGTTCTGCAGAACTGCGACATTTTCGCGAGGAAGCCGCTT
CGGGGCCAGGCGAATTTCATCACCGCTCAGGGACGAGAAGATGCGAATCAGAACACCGGCATTTCGATCCAGGGGTCCAGAGTCCGACCTGCAACTGATT
TTGCCGGTTCTTCTTCAATTCGGAGTTATTTGGGGAGGCCGTGGAAGGAGTACTAG
AA sequence
>Lus10009287 pacid=23141900 polypeptide=Lus10009287 locus=Lus10009287.g ID=Lus10009287.BGIv1.0 annot-version=v1.0
MAPQANISSNVGLLMSWTSATSKANFVVAKDGSGTHRSVNDAVEAAASGRRTSAERVVIHVKAGVYNERVEIPLHLKNLMLVGDDIDRTVITGSRNIPDG
STTYNSATFGNLCFGRPLLGEGHHVENTAAPQKHQAVALRVNSDQAFFYRCSFRGYHDTLFVHSLRQFYGDCHIYGTIDFIFGDASAVLQNCDIFARKPL
RGQANFITAQGREDANQNTGISIQGSRVRPATDFAGSSSIRSYLGRPWKEY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G60730 Plant invertase/pectin methyle... Lus10009287 0 1
AT1G57790 F-box family protein (.1) Lus10019204 1.0 0.9552
AT1G45616 AtRLP6 receptor like protein 6 (.1) Lus10005050 4.9 0.8150
AT3G54700 PHT1;7 phosphate transporter 1;7 (.1) Lus10022934 7.7 0.8044
AT1G48020 ATPMEI1 ARABIDOPSIS THALIANA PECTIN ME... Lus10001658 8.9 0.8044
AT1G01280 CYP703A2 "cytochrome P450, family 703, ... Lus10010119 10.0 0.8044
AT1G04110 SDD1 STOMATAL DENSITY AND DISTRIBUT... Lus10027892 11.0 0.8044
AT5G39130 RmlC-like cupins superfamily p... Lus10015129 11.8 0.8044
AT5G01180 ATPTR5 ARABIDOPSIS THALIANA PEPTIDE T... Lus10017177 12.6 0.8044
Lus10017294 13.4 0.8044
AT4G04960 Concanavalin A-like lectin pro... Lus10039837 14.1 0.8044

Lus10009287 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.