Lus10009299 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G01970 431 / 5e-151 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G19520 226 / 7e-68 NFD5 NUCLEAR FUSION DEFECTIVE 5, pentatricopeptide (PPR) repeat-containing protein (.1), pentatricopeptide (PPR) repeat-containing protein (.2)
AT2G18940 94 / 7e-21 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G35130 89 / 2e-19 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
AT5G39980 87 / 1e-18 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G59040 81 / 1e-16 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
AT1G18900 81 / 2e-16 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2), Pentatricopeptide repeat (PPR) superfamily protein (.3)
AT5G04810 79 / 5e-16 pentatricopeptide (PPR) repeat-containing protein (.1)
AT5G25630 79 / 6e-16 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
AT1G03560 79 / 7e-16 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030026 186 / 6e-53 AT1G19520 660 / 0.0 NUCLEAR FUSION DEFECTIVE 5, pentatricopeptide (PPR) repeat-containing protein (.1), pentatricopeptide (PPR) repeat-containing protein (.2)
Lus10035298 176 / 1e-49 AT1G19520 658 / 0.0 NUCLEAR FUSION DEFECTIVE 5, pentatricopeptide (PPR) repeat-containing protein (.1), pentatricopeptide (PPR) repeat-containing protein (.2)
Lus10015865 158 / 2e-48 AT1G01970 103 / 7e-28 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10015864 154 / 8e-47 AT1G01970 110 / 9e-30 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10027829 101 / 1e-23 AT3G59040 703 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10005058 99 / 2e-22 AT3G59040 623 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10018318 94 / 1e-20 AT2G35130 801 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10034342 88 / 7e-19 AT5G39980 970 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10026558 87 / 1e-18 AT5G65560 881 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G070500 437 / 2e-153 AT1G01970 469 / 7e-165 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.005G228200 217 / 9e-65 AT1G19520 649 / 0.0 NUCLEAR FUSION DEFECTIVE 5, pentatricopeptide (PPR) repeat-containing protein (.1), pentatricopeptide (PPR) repeat-containing protein (.2)
Potri.002G034900 150 / 7e-42 AT1G19520 296 / 2e-93 NUCLEAR FUSION DEFECTIVE 5, pentatricopeptide (PPR) repeat-containing protein (.1), pentatricopeptide (PPR) repeat-containing protein (.2)
Potri.012G123600 97 / 6e-22 AT2G35130 852 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.006G166200 89 / 2e-19 AT2G18940 1082 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.005G082400 88 / 6e-19 AT4G39620 625 / 0.0 EMBRYO DEFECTIVE 2453, A. THALIANA PENTATRICOPEPTIDE REPEAT 5, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.003G105700 87 / 2e-18 AT4G19440 758 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.002G010900 86 / 5e-18 AT5G42310 939 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.001G276500 86 / 5e-18 AT5G01110 863 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.006G049900 85 / 6e-18 AT2G41720 1169 / 0.0 EMBRYO DEFECTIVE 2654, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10009299 pacid=23141845 polypeptide=Lus10009299 locus=Lus10009299.g ID=Lus10009299.BGIv1.0 annot-version=v1.0
ATGGAAGGAGGTCGGGCTCAATATCACCAAGTTACAGAAACAGGCTATATCGCAACTCCCCCCGTGATGACCAACCGAAGCAAGGCGGTGATGAAACAGC
TGATTTGCTTCTCCGACAAAAAATGGAGCCTGGTGGAATTACTGAGTACTTGGGTTGATATCATGAAGCCCACCAGAGCTGAGTGGCTTTCAGTTCTCAA
GCAGCTGCTGGACACGGAGCATCCTTTGTACATTCAGGTGGCAGAATTTGCTTTACCGGAAGAATCTTTCGAGGCGAATATCCGGGACTACACAAAGCTA
ATCCACTACTACGGGAAGAAACACCAGCTCGAAGATGCCGAAAGGATCTTCTCATCAATGAAGGAAAGAGGCTTAGTTTACGATCAAGTAACAGTGACAG
CCATGGTTCACATGTACAGCAAGGCAGGCTACCACAAGAAGGCGGAAGAAACATTCCGCCAGCTTGCTCTGCTGGGCGAGCCATTAGATCACAGATCATA
CAGCTCAATGGTAATGTCCTACATCAGAGCTCAAATGCCCCATGAAGCAGAGTCTCTCCTCAAGAAAATGGACGACCAACAAATCCCGGCAGGGCGTGAA
GTTCACAAGGCATTGTTGAGAGCATACTCCATGGCTGGTGACGTGGAAGGGGCTCAGAGGGTATTTGACGCAATGCAGATGGCGGGTGTTGTTCCTGATG
ACAGAATATGTGCACTACTTATCAATGCTTATGGATTGGCTGGGGAGAGTGAGAATGCACGAATTGCGTTTGAGAACATGAGGAGGGCTGGTATTGAACC
AAGTGATAAGTGTGTGGCTTTGGTTCTGGGTGCATACGAGAAGGAGGAGAAGCTGAACCGGGCGTTGGAGTTTCTGGCGGGTTTGGAAAGAGATGGAGTT
ATGGTTGGGAAAGAAGCTTCGGCTATATTAGCTGGATGGTTTGGAAAGTTGGGAGTTTTGAAAGAAGTAGAGAGAGTACTAAGTGAATATGAAAATGCCT
CCAAGAGTTCTTCTGTGTTGCGATGA
AA sequence
>Lus10009299 pacid=23141845 polypeptide=Lus10009299 locus=Lus10009299.g ID=Lus10009299.BGIv1.0 annot-version=v1.0
MEGGRAQYHQVTETGYIATPPVMTNRSKAVMKQLICFSDKKWSLVELLSTWVDIMKPTRAEWLSVLKQLLDTEHPLYIQVAEFALPEESFEANIRDYTKL
IHYYGKKHQLEDAERIFSSMKERGLVYDQVTVTAMVHMYSKAGYHKKAEETFRQLALLGEPLDHRSYSSMVMSYIRAQMPHEAESLLKKMDDQQIPAGRE
VHKALLRAYSMAGDVEGAQRVFDAMQMAGVVPDDRICALLINAYGLAGESENARIAFENMRRAGIEPSDKCVALVLGAYEKEEKLNRALEFLAGLERDGV
MVGKEASAILAGWFGKLGVLKEVERVLSEYENASKSSSVLR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G01970 Tetratricopeptide repeat (TPR)... Lus10009299 0 1
AT4G34340 TAF8 TBP-associated factor 8 (.1) Lus10013818 3.7 0.8210
AT1G15710 prephenate dehydrogenase famil... Lus10011483 8.7 0.8219
AT1G31830 Amino acid permease family pro... Lus10007593 10.4 0.8116
AT2G15690 Tetratricopeptide repeat (TPR)... Lus10008570 10.7 0.8168
AT3G10110 MEE67 maternal effect embryo arrest ... Lus10020223 14.5 0.7795
AT2G37400 Tetratricopeptide repeat (TPR)... Lus10025299 15.6 0.8166
AT1G02700 unknown protein Lus10036329 16.3 0.7839
AT4G34340 TAF8 TBP-associated factor 8 (.1) Lus10026530 19.4 0.8027
AT5G16710 DHAR3 dehydroascorbate reductase 1 (... Lus10009135 21.0 0.8117
AT5G67220 FMN-linked oxidoreductases sup... Lus10006260 22.4 0.7765

Lus10009299 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.