Lus10009326 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G03550 49 / 2e-07 RING/U-box superfamily protein (.1)
AT1G72310 45 / 2e-06 ATL3 RING/U-box superfamily protein (.1)
AT1G72220 45 / 3e-06 RING/U-box superfamily protein (.1)
AT3G10910 45 / 3e-06 RING/U-box superfamily protein (.1)
AT5G17600 45 / 3e-06 RING/U-box superfamily protein (.1)
AT1G76410 44 / 5e-06 ATL8 RING/U-box superfamily protein (.1)
AT1G23980 44 / 5e-06 RING/U-box superfamily protein (.1)
AT2G42350 44 / 5e-06 RING/U-box superfamily protein (.1)
AT5G57750 44 / 6e-06 RING/U-box superfamily protein (.1)
AT3G62690 44 / 7e-06 ATL5 AtL5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015837 170 / 1e-55 AT1G20823 61 / 3e-12 RING/U-box superfamily protein (.1)
Lus10008797 48 / 4e-07 AT5G40250 77 / 2e-16 RING/U-box superfamily protein (.1)
Lus10036380 46 / 8e-07 AT5G05280 96 / 2e-25 RING/U-box superfamily protein (.1)
Lus10022223 46 / 1e-06 AT1G23980 81 / 2e-17 RING/U-box superfamily protein (.1)
Lus10008972 45 / 2e-06 AT5G06490 76 / 2e-17 RING/U-box superfamily protein (.1)
Lus10033425 45 / 3e-06 AT3G10910 82 / 6e-20 RING/U-box superfamily protein (.1)
Lus10035677 45 / 5e-06 AT3G03550 150 / 5e-42 RING/U-box superfamily protein (.1)
Lus10037264 45 / 6e-06 AT3G03550 144 / 3e-40 RING/U-box superfamily protein (.1)
Lus10032161 44 / 8e-06 AT5G40250 413 / 7e-144 RING/U-box superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G071300 46 / 1e-06 AT5G10380 135 / 1e-36 RING/U-box superfamily protein (.1)
Potri.005G113200 45 / 3e-06 AT2G17450 66 / 2e-13 RING-H2 finger A3A (.1)
Potri.001G159300 44 / 3e-06 AT5G05280 134 / 3e-40 RING/U-box superfamily protein (.1)
Potri.010G206200 44 / 3e-06 AT5G17600 91 / 6e-22 RING/U-box superfamily protein (.1)
Potri.003G073300 44 / 5e-06 AT1G53820 157 / 2e-46 RING/U-box superfamily protein (.1)
Potri.007G064401 44 / 5e-06 AT1G20823 118 / 2e-33 RING/U-box superfamily protein (.1)
Potri.001G351466 44 / 6e-06 AT5G40250 355 / 2e-121 RING/U-box superfamily protein (.1)
Potri.003G075200 43 / 8e-06 AT5G05280 137 / 2e-41 RING/U-box superfamily protein (.1)
Potri.008G071000 43 / 9e-06 AT3G11110 122 / 3e-36 RING/U-box superfamily protein (.1)
Potri.017G072300 44 / 1e-05 AT5G40250 372 / 7e-128 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger)
Representative CDS sequence
>Lus10009326 pacid=23141895 polypeptide=Lus10009326 locus=Lus10009326.g ID=Lus10009326.BGIv1.0 annot-version=v1.0
ATGTGGTGGCCATGGTGGCAATATCTATACTTTACGCTTCCGTTCCTAATTGCCCTCCTCGCCGTGCTATACATTCTCCGCGACCGTATAATCAACCGCG
GCGGCCACACTCCTCCGCAGCTGGTTCAGGGAAAAGGCACTACTACTGCGATCACTATTGACCTTCCGGGGAAGGTGATTAAGTATTACTGTGAAGAAGA
CGGCGGATGTGGCGGCGGATGTGCGATATGCTTGGAGGAGTGGGGAGAAGGAGACGAGTGTAGAGTGCTGCCGGAGTGCAACCACGTTTACCATAAGGTT
TGCGTTGACGGCTGGCTGTTGACCGGGGTCAACGACCATGATCAGTACCGTCGTTGTTGCCCGATTTGCCGCAGTTTTGTTTTTGACTCCAGTATTGTGT
GA
AA sequence
>Lus10009326 pacid=23141895 polypeptide=Lus10009326 locus=Lus10009326.g ID=Lus10009326.BGIv1.0 annot-version=v1.0
MWWPWWQYLYFTLPFLIALLAVLYILRDRIINRGGHTPPQLVQGKGTTTAITIDLPGKVIKYYCEEDGGCGGGCAICLEEWGEGDECRVLPECNHVYHKV
CVDGWLLTGVNDHDQYRRCCPICRSFVFDSSIV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G03550 RING/U-box superfamily protein... Lus10009326 0 1
AT5G17850 Sodium/calcium exchanger famil... Lus10005673 1.7 0.9355
AT4G24570 DIC2 dicarboxylate carrier 2 (.1) Lus10015570 2.0 0.9381
AT5G15870 glycosyl hydrolase family 81 p... Lus10042525 4.5 0.9333
AT2G03220 ATFUT1, ATFT1, ... MURUS 2, ARABIDOPSIS THALIANA ... Lus10013549 6.3 0.9508
AT1G05060 unknown protein Lus10030021 16.7 0.9350
AT5G05950 MEE60 maternal effect embryo arrest ... Lus10016474 20.2 0.9326
AT1G43790 TED6 tracheary element differentiat... Lus10029760 20.7 0.9312
AT1G66230 MYB ATMYB20 myb domain protein 20 (.1) Lus10002296 20.8 0.8925
AT5G03810 GDSL-like Lipase/Acylhydrolase... Lus10008635 26.0 0.9235
Lus10018742 26.8 0.9231

Lus10009326 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.