Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G63320 58 / 3e-11 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G63150 58 / 7e-11 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G63130 55 / 1e-09 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G63070 54 / 2e-09 pentatricopeptide (PPR) repeat-containing protein (.1) AT3G16710 54 / 2e-09 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G22470 54 / 3e-09 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G15930 53 / 5e-09 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G19290 53 / 5e-09 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G62930 52 / 7e-09 RPF3 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G63080 52 / 9e-09 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003446 [exp] 153 / 4e-48 AT1G62930 137 / 2e-37 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10003429 [exp] 152 / 6e-47 AT1G62930 173 / 1e-49 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10014245 [exp] 157 / 5e-46 AT1G12700 427 / 5e-141 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10014242 [exp] 152 / 2e-45 AT1G62930 256 / 5e-78 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10014244 [exp] 154 / 6e-45 AT1G12700 397 / 7e-130 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10014247 [exp] 153 / 8e-45 AT1G62930 340 / 3e-109 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10003447 [exp] 153 / 1e-44 AT1G12700 202 / 1e-56 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10003433 [exp] 153 / 1e-44 AT1G12700 396 / 2e-129 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10021074 [exp] 145 / 6e-43 AT1G62930 273 / 5e-86 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G117600 [exp] 80 / 2e-18 AT1G12700 330 / 1e-105 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.016G025600 [exp] 72 / 1e-15 AT3G22470 426 / 3e-141 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.013G149800 [exp] 71 / 2e-15 AT1G12700 482 / 6e-162 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G038400 [exp] 69 / 2e-14 AT1G12700 478 / 7e-161 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.007G068400 [exp] 68 / 3e-14 AT3G22470 300 / 8e-96 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.004G074500 [exp] 67 / 8e-14 AT1G62930 478 / 1e-162 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G050300 [exp] 66 / 1e-13 AT1G12700 466 / 5e-156 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G045000 [exp] 65 / 3e-13 AT1G12700 502 / 4e-170 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.006G257300 [exp] 65 / 3e-13 AT1G62930 481 / 3e-163 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G050500 [exp] 64 / 5e-13 AT1G12700 523 / 2e-178 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10009331 pacid=23148917 polypeptide=Lus10009331 locus=Lus10009331.g ID=Lus10009331.BGIv1.0 annot-version=v1.0 ATGGTTTTTGGGCTTCATATATTTACTGGAAGGGTTAAAGAAGCAAGAGACATGTTTTCTAGGCTCTCTAAAGATGAGAGTTTACAGCCTAGTGTCTACA CATATAGCACCGTAATTGATGGACTTTGTAGACATGGGTTGGTAGATGAAGCATATGATTTGTTTAGAACAATGGAGAGGAATCCACTCGAAGCAGTAGA CCTAATACAAGAGATGGTGTCTAAGGGTTTCTCAGCTGATGCAACCACATTGGAATTGCTGTTAGAATTGTTGCCCAAAAACCAATTGGATCATCCACTT CTCAGGAAGCTGGTAGGTGATAGTGAAGAGATAAAGCCTAAGGAGGGTTTATCAGCAGATACTAGTACTCCGTTATAA
AA sequence Show only first row Show all	>Lus10009331 pacid=23148917 polypeptide=Lus10009331 locus=Lus10009331.g ID=Lus10009331.BGIv1.0 annot-version=v1.0 MVFGLHIFTGRVKEARDMFSRLSKDESLQPSVYTYSTVIDGLCRHGLVDEAYDLFRTMERNPLEAVDLIQEMVSKGFSADATTLELLLELLPKNQLDHPL LRKLVGDSEEIKPKEGLSADTSTPL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G63320			Pentatricopeptide repeat (PPR)...		Lus10009331 [exp]	0	1
AT4G22310			Uncharacterised protein family...		Lus10032564 [exp]	3.0	0.8053
AT4G27410	NAC	RD26, ANAC072	NAC (No Apical Meristem) domai...		Lus10003458 [exp]	4.0	0.7513
AT2G45400		BEN1	NAD(P)-binding Rossmann-fold s...		Lus10004029 [exp]	4.5	0.7187
AT1G19250		FMO1	flavin-dependent monooxygenase...		Lus10008454 [exp]	6.0	0.7026
AT1G33540		SCPL18	serine carboxypeptidase-like 1...		Lus10011710 [exp]	8.7	0.7705
AT3G20640	bHLH	bHLH123	basic helix-loop-helix (bHLH) ...		Lus10029460 [exp]	9.3	0.7800
AT3G49700		AtACS9, ACS9, E...	ETHYLENE OVERPRODUCING 3, 1-am...		Lus10007249 [exp]	16.0	0.6872
					Lus10030838 [exp]	20.8	0.6387
AT1G69630			F-box/RNI-like superfamily pro...		Lus10031499 [exp]	23.7	0.6392
AT4G14805			Bifunctional inhibitor/lipid-t...		Lus10010576 [exp]	29.4	0.5733

Compare expression of checked genes

Lus10009331 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.