Plant FIBer expression Database

Lus10009345 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G23440 41 / 3e-06 unknown protein
AT5G66816 40 / 1e-05 unknown protein
AT5G66815 40 / 2e-05 unknown protein
AT3G50610 40 / 4e-05 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002969
[exp]
111 / 8e-34 AT2G23440 44 / 7e-07 unknown protein
Lus10009347
[exp]
39 / 3e-05 AT2G23440 50 / 2e-09 unknown protein
Lus10009346
[exp]
40 / 6e-05 AT3G50610 108 / 5e-28 unknown protein
Lus10002970
[exp]
40 / 7e-05 AT3G50610 98 / 2e-24 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G041400
[exp]
48 / 1e-08 AT2G23440 45 / 2e-07 unknown protein
Potri.007G042000
[exp]
46 / 7e-08 AT5G66816 43 / 2e-06 unknown protein
Potri.005G136800
[exp]
45 / 2e-07 AT5G66816 45 / 4e-07 unknown protein
Potri.007G041500
[exp]
40 / 9e-06 AT2G23440 54 / 3e-11 unknown protein
Potri.014G034500
[exp]
38 / 6e-05 AT5G66815 43 / 1e-06 unknown protein
Potri.005G136700
[exp]
39 / 9e-05 AT3G50610 78 / 1e-16 unknown protein
PFAM info
Representative CDS sequence
>Lus10009345 pacid=23148889 polypeptide=Lus10009345 locus=Lus10009345.g ID=Lus10009345.BGIv1.0 annot-version=v1.0
ATGGCAATCAACAGACAAATAGTCATTTGTGTTGTTATGGTCCTGCTCATTTTGTCGCATAACGACGACATTTCATGTGTACAAGGCAGACATTTGAGGC
GGCCGGGGAGAAGTACCAACCACCATCGAACATCGACCAAGGTGGTGAAGACTCCGGTCGTGGTTGGTGGCAATAGGGTGACGAAGATGGATTACAATGT
GGACGATTTCCGACCAACGGCTCCCGGACATAGCCCCGGGGTTGGCCACTCCATCAACAATTAA
AA sequence
>Lus10009345 pacid=23148889 polypeptide=Lus10009345 locus=Lus10009345.g ID=Lus10009345.BGIv1.0 annot-version=v1.0
MAINRQIVICVVMVLLILSHNDDISCVQGRHLRRPGRSTNHHRTSTKVVKTPVVVGGNRVTKMDYNVDDFRPTAPGHSPGVGHSINN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G23440 unknown protein Lus10009345
[exp]
0 1
AT2G39855 unknown protein Lus10009870
[exp]
2.4 0.8131
AT3G12890 ASML2 activator of spomin::LUC2 (.1) Lus10031770
[exp]
4.5 0.7827
AT5G26620 unknown protein Lus10001512
[exp]
9.7 0.8076
AT4G19510 Disease resistance protein (TI... Lus10008318
[exp]
17.7 0.7493
AT3G26510 Octicosapeptide/Phox/Bem1p fam... Lus10006214
[exp]
22.4 0.7870
AT2G38110 ATGPAT6, GPAT6 glycerol-3-phosphate acyltrans... Lus10036684
[exp]
22.9 0.7190
AT3G05610 Plant invertase/pectin methyle... Lus10031469
[exp]
29.8 0.7609
AT2G16630 Pollen Ole e 1 allergen and ex... Lus10026279
[exp]
31.5 0.7673
AT1G11600 CYP77B1 "cytochrome P450, family 77, s... Lus10007659
[exp]
33.6 0.7591
AT2G26910 PEC1, ABCG32, P... PERMEABLE CUTICLE 1, ATP-bindi... Lus10043305
[exp]
38.3 0.7586

Lus10009345 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.