Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G23440 44 / 3e-07 unknown protein AT5G66815 40 / 2e-05 unknown protein AT5G66816 38 / 0.0001 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009345 [exp] 41 / 8e-06 AT2G23440 42 / 1e-06 unknown protein Lus10002969 [exp] 40 / 1e-05 AT2G23440 44 / 7e-07 unknown protein Lus10033285 [exp] 37 / 0.0006 AT2G35612 42 / 1e-05 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G136800 [exp] 43 / 1e-06 AT5G66816 45 / 4e-07 unknown protein Potri.007G041500 [exp] 43 / 1e-06 AT2G23440 54 / 3e-11 unknown protein Potri.007G041400 [exp] 41 / 6e-06 AT2G23440 45 / 2e-07 unknown protein Potri.007G042000 [exp] 41 / 8e-06 AT5G66816 43 / 2e-06 unknown protein Potri.004G234800 [exp] 38 / 0.0002 AT2G35612 64 / 6e-15 unknown protein Potri.014G034500 [exp] 37 / 0.0003 AT5G66815 43 / 1e-06 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10009347 pacid=23148880 polypeptide=Lus10009347 locus=Lus10009347.g ID=Lus10009347.BGIv1.0 annot-version=v1.0 ATGGCCAAACTAGCTCCTTCCACATTCCTTCTTCTTTTGATCCTCATTCTCTCCCAAGAACCTCACTCCATTGGTGCTGCAAGGCACCTCAAAGTTTACC AAAATACCCTTACCAACACAGTTAGCAACACCAAAGAGTATCCTACCATCAATGCAGCAATATCAGAGTCTCTCGACGTGCCTGCTCCTCCGTCCACCGA TGAGCCACAGCCACCGCCTTCCCCAGCTGGACGCGGGGTCGACGGTTTCAGGCCCACCACCCCGGGCCACAGCCCGGGCGTTGGACATTCCACGCATAAC TAG
AA sequence Show only first row Show all	>Lus10009347 pacid=23148880 polypeptide=Lus10009347 locus=Lus10009347.g ID=Lus10009347.BGIv1.0 annot-version=v1.0 MAKLAPSTFLLLLILILSQEPHSIGAARHLKVYQNTLTNTVSNTKEYPTINAAISESLDVPAPPSTDEPQPPPSPAGRGVDGFRPTTPGHSPGVGHSTHN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G23440			unknown protein		Lus10009347 [exp]	0	1
AT5G51490			Plant invertase/pectin methyle...		Lus10031141 [exp]	1.4	0.7608
AT1G17930			Aminotransferase-like, plant m...		Lus10012081 [exp]	8.5	0.7396
AT3G03450	GRAS	RGL2	RGA-like 2 (.1)		Lus10016891 [exp]	10.4	0.6964
AT5G36930			Disease resistance protein (TI...		Lus10014303 [exp]	38.4	0.6493
AT5G64620		ATC/VIF2, C/VIF...	cell wall / vacuolar inhibitor...		Lus10020664 [exp]	44.4	0.7024
AT1G06660		JASON	JASON, unknown protein		Lus10001051 [exp]	78.3	0.6138
AT5G11260	bZIP	TED5, HY5	REVERSAL OF THE DET PHENOTYPE ...		Lus10002900 [exp]	84.7	0.6491
AT3G21260		GLTP3	GLYCOLIPID TRANSFER PROTEIN 3,...		Lus10018917 [exp]	120.9	0.6312
AT4G13420		HAK5, ATHAK5	high affinity K+ transporter 5...		Lus10005194 [exp]	122.4	0.6025
AT1G04670			unknown protein		Lus10002298 [exp]	122.7	0.6025

Compare expression of checked genes

Lus10009347 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.