Lus10009354 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G31420 57 / 2e-10 B3 Domain of unknown function (DUF313) (.1)
AT2G27410 51 / 3e-08 B3 Domain of unknown function (DUF313) (.1)
AT2G32645 45 / 2e-06 Domain of unknown function (DUF313) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027272 191 / 2e-62 AT2G27410 66 / 9e-13 Domain of unknown function (DUF313) (.1)
Lus10027284 192 / 2e-61 AT2G27410 67 / 2e-12 Domain of unknown function (DUF313) (.1)
Lus10038980 189 / 3e-60 AT2G27410 69 / 3e-13 Domain of unknown function (DUF313) (.1)
Lus10015934 83 / 7e-20 AT2G27410 48 / 3e-06 Domain of unknown function (DUF313) (.1)
Lus10035393 80 / 1e-19 AT2G27410 68 / 4e-14 Domain of unknown function (DUF313) (.1)
Lus10030996 83 / 2e-19 AT2G27410 63 / 3e-11 Domain of unknown function (DUF313) (.1)
Lus10035394 78 / 1e-18 AT2G27410 61 / 1e-11 Domain of unknown function (DUF313) (.1)
Lus10030994 75 / 2e-16 AT2G27410 60 / 4e-10 Domain of unknown function (DUF313) (.1)
Lus10027287 51 / 2e-08 AT2G31420 47 / 1e-06 Domain of unknown function (DUF313) (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G014200 39 / 0.0006 AT3G24850 73 / 2e-14 Domain of unknown function (DUF313) (.1)
Potri.015G014700 39 / 0.0006 AT3G24850 75 / 8e-15 Domain of unknown function (DUF313) (.1)
PFAM info
Representative CDS sequence
>Lus10009354 pacid=23148902 polypeptide=Lus10009354 locus=Lus10009354.g ID=Lus10009354.BGIv1.0 annot-version=v1.0
ATGCAACATTGTCTTTCGATCCCTAGGACGAAGATTGCGAACGAGATTTTGACGGATGGAGAGAAGAGGGAACTGGACGCGGCTAGGAAAACCAAGATTG
GGTGTTTTGTAGATCCGGATATGGAGGTTTCGCATCAAGTGTCGTTGAGGAGGTGGGGGGTGGACATGGAAAACATCTTCGGACAAGGATGGAAGAAGTT
GCTGACGAAGCAATGGCGCAACCTTATTGATCTTGCTGAAAACGATGTGGTGGAGCTCTGGAGTTTCTGGTCCCCTTCAGGGGAGCTCTGTTTTGTACTG
GTTACTTTGAAAGCAAGGCAAGCTGCTGCTGACAAGGAACACCAAGGATTAATGATGACTCGAGAAGAAGAAGAAAGCCATCTTCAGATTGTGTCTATCG
GCTACTGCCCTCATATTGATTTGACTCTTAAACTCTAA
AA sequence
>Lus10009354 pacid=23148902 polypeptide=Lus10009354 locus=Lus10009354.g ID=Lus10009354.BGIv1.0 annot-version=v1.0
MQHCLSIPRTKIANEILTDGEKRELDAARKTKIGCFVDPDMEVSHQVSLRRWGVDMENIFGQGWKKLLTKQWRNLIDLAENDVVELWSFWSPSGELCFVL
VTLKARQAAADKEHQGLMMTREEEESHLQIVSIGYCPHIDLTLKL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G31420 B3 Domain of unknown function (DU... Lus10009354 0 1
Lus10038177 3.5 0.7303
AT5G20230 SAG14, ATBCB SENESCENCE ASSOCIATED GENE 14,... Lus10025752 5.7 0.7236
AT4G34850 LAP5 LESS ADHESIVE POLLEN 5, Chalco... Lus10042388 6.3 0.7211
AT2G01770 ATVIT1, VIT1 vacuolar iron transporter 1 (.... Lus10034583 6.5 0.7550
AT5G59600 Tetratricopeptide repeat (TPR)... Lus10040779 8.3 0.6792
AT3G55400 OVA1 OVULE ABORTION 1, methionyl-tR... Lus10001706 15.0 0.6594
AT5G61890 AP2_ERF Integrase-type DNA-binding sup... Lus10006796 19.9 0.6679
AT5G02500 AtHsp70-1, AT-H... HEAT SHOCK PROTEIN 70-1, ARABI... Lus10009072 24.9 0.6404
AT3G01570 Oleosin family protein (.1) Lus10028035 34.5 0.5571
AT1G18190 GC2 golgin candidate 2 (.1) Lus10009060 44.1 0.7029

Lus10009354 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.