Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G57870 306 / 7e-109 SCE1A, SCE1, AHUS5, EMB1637, ATSCE1 SUMO CONJUGATING ENZYME 1A, EMBRYO DEFECTIVE 1637, sumo conjugation enzyme 1 (.1) AT2G02760 123 / 2e-36 ATUBC2 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) AT1G14400 121 / 1e-35 ATUBC1, UBC1 UBIQUITIN CONJUGATING ENZYME 1, ubiquitin carrier protein 1 (.1.2) AT5G62540 113 / 1e-32 UBC3 ubiquitin-conjugating enzyme 3 (.1) AT1G64230 103 / 6e-29 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) AT5G41700 103 / 6e-29 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) AT4G27960 103 / 9e-29 UBC9 ubiquitin conjugating enzyme 9 (.1.2) AT5G53300 103 / 1e-28 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4) AT3G08690 100 / 1e-27 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2) AT3G08700 99 / 5e-27 UBC12 ubiquitin-conjugating enzyme 12 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019327 [exp] 333 / 2e-119 AT3G57870 308 / 2e-109 SUMO CONJUGATING ENZYME 1A, EMBRYO DEFECTIVE 1637, sumo conjugation enzyme 1 (.1) Lus10019328 [exp] 333 / 3e-119 AT3G57870 308 / 3e-109 SUMO CONJUGATING ENZYME 1A, EMBRYO DEFECTIVE 1637, sumo conjugation enzyme 1 (.1) Lus10009377 [exp] 330 / 5e-118 AT3G57870 306 / 1e-108 SUMO CONJUGATING ENZYME 1A, EMBRYO DEFECTIVE 1637, sumo conjugation enzyme 1 (.1) Lus10036727 [exp] 122 / 7e-36 AT2G02760 310 / 1e-110 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10037203 [exp] 122 / 7e-36 AT2G02760 310 / 1e-110 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10030786 [exp] 119 / 8e-35 AT2G02760 305 / 2e-108 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10013263 [exp] 118 / 2e-34 AT2G02760 304 / 6e-108 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10009422 [exp] 109 / 7e-31 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2) Lus10028700 [exp] 109 / 7e-31 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G141100 [exp] 324 / 1e-115 AT3G57870 303 / 1e-107 SUMO CONJUGATING ENZYME 1A, EMBRYO DEFECTIVE 1637, sumo conjugation enzyme 1 (.1) Potri.014G024950 [exp] 293 / 1e-103 AT3G57870 291 / 6e-103 SUMO CONJUGATING ENZYME 1A, EMBRYO DEFECTIVE 1637, sumo conjugation enzyme 1 (.1) Potri.002G123600 [exp] 292 / 4e-103 AT3G57870 283 / 1e-99 SUMO CONJUGATING ENZYME 1A, EMBRYO DEFECTIVE 1637, sumo conjugation enzyme 1 (.1) Potri.014G024801 [exp] 291 / 9e-103 AT3G57870 251 / 5e-87 SUMO CONJUGATING ENZYME 1A, EMBRYO DEFECTIVE 1637, sumo conjugation enzyme 1 (.1) Potri.015G064000 [exp] 124 / 1e-36 AT2G02760 284 / 3e-100 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Potri.013G064400 [exp] 123 / 1e-36 AT2G02760 313 / 1e-111 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Potri.019G039200 [exp] 122 / 3e-36 AT2G02760 285 / 2e-100 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Potri.003G136200 [exp] 104 / 3e-29 AT1G64230 304 / 4e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.006G110200 [exp] 104 / 3e-29 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) Potri.016G138900 [exp] 103 / 6e-29 AT1G64230 304 / 3e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0208 [flax] [poplar] UBC PF00179 [flax] [poplar] UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence Show only first row Show all	>Lus10009376 pacid=23148892 polypeptide=Lus10009376 locus=Lus10009376.g ID=Lus10009376.BGIv1.0 annot-version=v1.0 ATGTCCGGTGGAATCGCCCGAGGTCGTCTGGCGGAGGAAAGGAAGTCCTGGCGCAAGAACCATCCCCATGGTTTTGTGGCGAAGCCTGAAACTCTGCCAG ATGGAACAGTGAATCTGATGGTCTGGCATTGCACCATCCCTGGGAAGGCTGGGACTGACTGGGAGGGTGGTTACTTCCCTCTCACTCTCAACTTCAGTGA AGACTATCCTAGCAAGCCACCAAAGTGCAAATTTCCTCAAGGCTTCTTCCATCCCAACGTCTACCCTTCAGGAACTGTTTGTCTCTCTATCCTTAACGAA GACAGCGGTTGGAGACCAGCTATCACAGTGAAGCAAATTCTAGTCGGAATCCAGGATCTCCTAGACCAGCCTAACCCTGCTGACCCTGCACAGACCGAAG GCTATCATCTCTTCATCCAGGACCCTACGGAGTACAAGAAGAGGGTACGCCAGCAATCGAAGCAGTACCCTCCGCTAGTGTAG
AA sequence Show only first row Show all	>Lus10009376 pacid=23148892 polypeptide=Lus10009376 locus=Lus10009376.g ID=Lus10009376.BGIv1.0 annot-version=v1.0 MSGGIARGRLAEERKSWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGYFPLTLNFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNE DSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDPTEYKKRVRQQSKQYPPLV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G57870		SCE1A, SCE1, AH...	SUMO CONJUGATING ENZYME 1A, EM...		Lus10009376 [exp]	0	1
AT1G11905			B-cell receptor-associated pro...		Lus10020025 [exp]	1.0	0.9685
AT5G44250			Protein of unknown function DU...		Lus10021741 [exp]	1.4	0.9588
AT3G10915			Reticulon family protein (.1.2...		Lus10029041 [exp]	2.8	0.9534
AT4G26060			Ribosomal protein L18ae family...		Lus10011943 [exp]	3.2	0.9512
					Lus10017210 [exp]	3.5	0.9492
AT1G78895			Reticulon family protein (.1)		Lus10033352 [exp]	4.2	0.9529
AT3G62420	bZIP	ATBZIP53	basic region/leucine zipper mo...		Lus10010005 [exp]	4.5	0.9553
AT1G09390			GDSL-like Lipase/Acylhydrolase...		Lus10031438 [exp]	4.6	0.9436
AT1G44770			unknown protein		Lus10034500 [exp]	5.2	0.9586
AT4G30340		ATDGK7	diacylglycerol kinase 7 (.1)		Lus10015514 [exp]	5.3	0.9535

Compare expression of checked genes

Lus10009376 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.