Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G57870 306 / 1e-108 SCE1A, SCE1, AHUS5, EMB1637, ATSCE1 SUMO CONJUGATING ENZYME 1A, EMBRYO DEFECTIVE 1637, sumo conjugation enzyme 1 (.1) AT2G02760 123 / 2e-36 ATUBC2 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) AT1G14400 120 / 1e-35 ATUBC1, UBC1 UBIQUITIN CONJUGATING ENZYME 1, ubiquitin carrier protein 1 (.1.2) AT5G62540 113 / 1e-32 UBC3 ubiquitin-conjugating enzyme 3 (.1) AT1G64230 104 / 5e-29 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) AT5G41700 104 / 5e-29 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) AT4G27960 102 / 2e-28 UBC9 ubiquitin conjugating enzyme 9 (.1.2) AT5G53300 102 / 3e-28 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4) AT5G56150 100 / 2e-27 UBC30 ubiquitin-conjugating enzyme 30 (.1.2) AT3G08690 100 / 3e-27 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019327 [exp] 332 / 1e-118 AT3G57870 308 / 2e-109 SUMO CONJUGATING ENZYME 1A, EMBRYO DEFECTIVE 1637, sumo conjugation enzyme 1 (.1) Lus10009376 [exp] 330 / 5e-118 AT3G57870 306 / 7e-109 SUMO CONJUGATING ENZYME 1A, EMBRYO DEFECTIVE 1637, sumo conjugation enzyme 1 (.1) Lus10019328 [exp] 328 / 4e-117 AT3G57870 308 / 3e-109 SUMO CONJUGATING ENZYME 1A, EMBRYO DEFECTIVE 1637, sumo conjugation enzyme 1 (.1) Lus10036727 [exp] 122 / 6e-36 AT2G02760 310 / 1e-110 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10037203 [exp] 122 / 6e-36 AT2G02760 310 / 1e-110 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10030786 [exp] 119 / 9e-35 AT2G02760 305 / 2e-108 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10013263 [exp] 118 / 2e-34 AT2G02760 304 / 6e-108 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10009422 [exp] 107 / 3e-30 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2) Lus10028700 [exp] 107 / 3e-30 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G141100 [exp] 320 / 3e-114 AT3G57870 303 / 1e-107 SUMO CONJUGATING ENZYME 1A, EMBRYO DEFECTIVE 1637, sumo conjugation enzyme 1 (.1) Potri.014G024950 [exp] 290 / 4e-102 AT3G57870 291 / 6e-103 SUMO CONJUGATING ENZYME 1A, EMBRYO DEFECTIVE 1637, sumo conjugation enzyme 1 (.1) Potri.002G123600 [exp] 288 / 1e-101 AT3G57870 283 / 1e-99 SUMO CONJUGATING ENZYME 1A, EMBRYO DEFECTIVE 1637, sumo conjugation enzyme 1 (.1) Potri.014G024801 [exp] 287 / 4e-101 AT3G57870 251 / 5e-87 SUMO CONJUGATING ENZYME 1A, EMBRYO DEFECTIVE 1637, sumo conjugation enzyme 1 (.1) Potri.015G064000 [exp] 124 / 1e-36 AT2G02760 284 / 3e-100 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Potri.013G064400 [exp] 123 / 1e-36 AT2G02760 313 / 1e-111 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Potri.019G039200 [exp] 122 / 3e-36 AT2G02760 285 / 2e-100 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Potri.019G083800 [exp] 104 / 5e-29 AT5G56150 280 / 1e-98 ubiquitin-conjugating enzyme 30 (.1.2) Potri.016G138900 [exp] 104 / 5e-29 AT1G64230 304 / 3e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.003G136200 [exp] 103 / 7e-29 AT1G64230 304 / 4e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0208 [flax] [poplar] UBC PF00179 [flax] [poplar] UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence Show only first row Show all	>Lus10009377 pacid=23148877 polypeptide=Lus10009377 locus=Lus10009377.g ID=Lus10009377.BGIv1.0 annot-version=v1.0 ATGTCCGGTGGAATTGCCCGTGGTCGTCTGGCGGAGGAAAGGAAGTCCTGGCGCAAGAACCATCCTCATGGTTTTGTAGCAAAGCCGGAGACTTTGCCAG ATGGAACTGTGAATTTGATGGTGTGGCATTGCACCATCCCTGGGAAGGCTGGGACTGATTGGGAGGGTGGTTGCTTCCCACTCACTCTCAACTTCAGTGA AGACTATCCGAGCAAGCCACCAAAGTGCAAATTTCCTCAAGGTTTCTTCCACCCTAACGTCTACCCTTCAGGAACTGTTTGTTTGTCCATCCTTAACGAG GACAGTGGCTGGAGACCAGCTATCACAGTGAAGCAAATTCTAGTCGGTATCCAGGATCTCCTGGACCAGCCAAACCCAGCTGACCCTGCACAAACTGAAG GCTATCATCTCTTCATCCAGGACCCTGTGGAGTACAAGAAGAGGGTACGCCAGCAATCGAAGCAGTATCCTCCACTCGTGTAG
AA sequence Show only first row Show all	>Lus10009377 pacid=23148877 polypeptide=Lus10009377 locus=Lus10009377.g ID=Lus10009377.BGIv1.0 annot-version=v1.0 MSGGIARGRLAEERKSWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGCFPLTLNFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNE DSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDPVEYKKRVRQQSKQYPPLV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G57870		SCE1A, SCE1, AH...	SUMO CONJUGATING ENZYME 1A, EM...		Lus10009377 [exp]	0	1
AT1G68090		ANN5, ANNAT5	ANNEXIN ARABIDOPSIS THALIANA 5...		Lus10037992 [exp]	2.8	0.8900
AT1G52740		HTA9	histone H2A protein 9 (.1)		Lus10019447 [exp]	6.0	0.8676
AT5G03030			Chaperone DnaJ-domain superfam...		Lus10040376 [exp]	11.4	0.8828
AT1G49050			Eukaryotic aspartyl protease f...		Lus10042982 [exp]	11.8	0.8617
AT4G27250			NAD(P)-binding Rossmann-fold s...		Lus10016968 [exp]	13.6	0.8077
AT3G23360			Protein phosphatase 2C family ...		Lus10021171 [exp]	13.8	0.8453
AT1G64750		DSS1(I), ATDSS1...	deletion of SUV3 suppressor 1(...		Lus10030906 [exp]	15.1	0.8505
AT2G21620		RD2	Adenine nucleotide alpha hydro...		Lus10026346 [exp]	15.5	0.8377
AT5G05080		ATUBC22, UBC22	ubiquitin-conjugating enzyme 2...		Lus10010433 [exp]	16.5	0.8412
AT1G66240		ATX1, ATATX1	homolog of anti-oxidant 1 (.1....		Lus10028859 [exp]	20.5	0.8447

Compare expression of checked genes

Lus10009377 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.