Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020529 [exp] 81 / 4e-21 ND / Lus10020530 [exp] 75 / 1e-18 ND / Lus10009379 [exp] 73 / 5e-18 ND / Lus10009380 [exp] 71 / 6e-17 ND / Lus10020528 [exp] 47 / 1e-07 ND / Lus10000363 [exp] 40 / 3e-05 ND / Lus10020527 [exp] 39 / 0.0001 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10009381 pacid=23142596 polypeptide=Lus10009381 locus=Lus10009381.g ID=Lus10009381.BGIv1.0 annot-version=v1.0 ATGATCCGTTACCACTCACTGTTTCTCTTATCAGACTATGTGCTTAAGTACGCTATTTACAAACTCGTTACTGAGAATGACTACGGGGCTGGGGTCACGT ATCCGGTTGAAGGTGGCGCTAGCTCCGAAGCACACTGCTCGTTGGAGGACCTTGGTGACTGCAATGACTGTCTGAATAAGCTGCTACCATATGTGAACCA GTGCTCCTCCTATGACTCGGGTTCGGCTTCGTACGATGACAAGTGCAGCCTCAGCTTCAAGGTTTCTTGA
AA sequence Show only first row Show all	>Lus10009381 pacid=23142596 polypeptide=Lus10009381 locus=Lus10009381.g ID=Lus10009381.BGIv1.0 annot-version=v1.0 MIRYHSLFLLSDYVLKYAIYKLVTENDYGAGVTYPVEGGASSEAHCSLEDLGDCNDCLNKLLPYVNQCSSYDSGSASYDDKCSLSFKVS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10009381 [exp]	0	1
					Lus10004635 [exp]	1.0	0.9157
AT5G45840			Leucine-rich repeat protein ki...		Lus10007281 [exp]	2.4	0.9150
					Lus10040835 [exp]	3.0	0.9126
AT3G14250			RING/U-box superfamily protein...		Lus10000412 [exp]	3.2	0.7993
AT4G35420		TKPR1, DRL1	tetraketide alpha-pyrone reduc...		Lus10006141 [exp]	4.0	0.9089
AT1G65810			P-loop containing nucleoside t...		Lus10035774 [exp]	4.5	0.8687
					Lus10008678 [exp]	5.1	0.7692
AT4G12300		CYP706A4	"cytochrome P450, family 706, ...		Lus10024577 [exp]	5.3	0.8261
AT5G25910		AtRLP52	receptor like protein 52 (.1)		Lus10016112 [exp]	6.7	0.8144
AT2G29880			unknown protein		Lus10005028 [exp]	6.9	0.7784

Compare expression of checked genes

Lus10009381 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.