Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G72920 63 / 3e-13 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT1G27170 63 / 4e-13 transmembrane receptors;ATP binding (.1.2) AT1G72900 62 / 1e-12 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT5G36930 61 / 2e-12 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G72940 60 / 6e-12 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G72840 59 / 9e-12 Disease resistance protein (TIR-NBS-LRR class) (.1), Disease resistance protein (TIR-NBS-LRR class) (.2) AT1G72890 58 / 2e-11 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2) AT1G17615 58 / 2e-11 Disease resistance protein (TIR-NBS class) (.1) AT1G72910 58 / 2e-11 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G27180 57 / 6e-11 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020534 [exp] 164 / 2e-48 AT5G36930 414 / 1e-124 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10020533 [exp] 147 / 1e-42 AT1G27170 405 / 1e-122 transmembrane receptors;ATP binding (.1.2) Lus10020536 [exp] 133 / 1e-37 AT1G27170 392 / 8e-118 transmembrane receptors;ATP binding (.1.2) Lus10020537 [exp] 127 / 1e-35 AT1G27170 404 / 6e-121 transmembrane receptors;ATP binding (.1.2) Lus10008415 [exp] 109 / 8e-32 AT5G36930 137 / 5e-38 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10010574 [exp] 108 / 7e-29 AT5G36930 397 / 4e-119 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10026961 [exp] 105 / 6e-28 AT5G36930 420 / 2e-126 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10004911 [exp] 103 / 2e-27 AT1G27170 387 / 5e-115 transmembrane receptors;ATP binding (.1.2) Lus10004905 [exp] 103 / 3e-27 AT1G27170 90 / 6e-20 transmembrane receptors;ATP binding (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G046000 [exp] 81 / 1e-19 AT5G36930 496 / 1e-162 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002428 [exp] 80 / 4e-19 AT5G36930 387 / 2e-122 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002400 [exp] 80 / 4e-19 AT5G36930 658 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G019053 [exp] 80 / 5e-19 AT5G36930 655 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.007G142600 [exp] 79 / 7e-19 AT5G36930 535 / 5e-173 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T001500 [exp] 79 / 8e-19 AT5G36930 641 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G021681 [exp] 79 / 8e-19 AT5G36930 641 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T001933 [exp] 79 / 9e-19 AT5G36930 617 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G019710 [exp] 79 / 1e-18 AT5G36930 445 / 2e-144 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.007G143300 [exp] 78 / 2e-18 AT5G36930 519 / 2e-162 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [flax] [poplar] STIR PF01582 [flax] [poplar] TIR TIR domain
Representative CDS sequence Show only first row Show all	>Lus10009384 pacid=23142604 polypeptide=Lus10009384 locus=Lus10009384.g ID=Lus10009384.BGIv1.0 annot-version=v1.0 ATGATGAGATCCGACTCTGATGGCTCCATTGACTCTTTCCATTCACGTGCATATGTCGATCCAACATTACTCCCTCTTCCATCTGGAGAGTATGAGGTTT TCTTGAGCTTTAGAGGCCCAGATGTCCGCCAAACTTTTGCTGACCATCTGTACACAAGCCTTGTTCGTTCCAAAATCCGCACATTTAGAGACAAGGAAGG ACTCCATAAGGGGGAAACTATTGCCCGATCTCTAATCCAGGCTATTACCGAATCTAAGATCTAG
AA sequence Show only first row Show all	>Lus10009384 pacid=23142604 polypeptide=Lus10009384 locus=Lus10009384.g ID=Lus10009384.BGIv1.0 annot-version=v1.0 MMRSDSDGSIDSFHSRAYVDPTLLPLPSGEYEVFLSFRGPDVRQTFADHLYTSLVRSKIRTFRDKEGLHKGETIARSLIQAITESKI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G72890			Disease resistance protein (TI...		Lus10009384 [exp]	0	1
AT1G74920		ALDH10A8	aldehyde dehydrogenase 10A8 (....		Lus10004238 [exp]	1.0	0.8527
AT2G39260			binding;RNA binding (.1)		Lus10030801 [exp]	4.9	0.8509
					Lus10017219 [exp]	6.9	0.8419
AT3G12620			Protein phosphatase 2C family ...		Lus10040346 [exp]	7.1	0.7804
AT1G05170			Galactosyltransferase family p...		Lus10002079 [exp]	8.1	0.8353
AT2G32760			unknown protein		Lus10022575 [exp]	9.2	0.7891
AT3G59570			Ypt/Rab-GAP domain of gyp1p su...		Lus10022963 [exp]	10.0	0.7701
AT5G55500		ATXYLT	"beta-1,2-xylosyltransferase",...		Lus10014902 [exp]	10.4	0.8165
AT4G11170			Disease resistance protein (TI...		Lus10010222 [exp]	11.3	0.8376
					Lus10005785 [exp]	14.5	0.7916

Compare expression of checked genes

Lus10009384 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.