Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G35980 66 / 3e-16 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041889 [exp] 84 / 2e-23 AT4G35980 141 / 1e-45 unknown protein Lus10028436 [exp] 81 / 2e-22 AT4G35980 139 / 9e-45 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G111900 [exp] 70 / 5e-18 AT4G35980 139 / 5e-45 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10009388 pacid=23142631 polypeptide=Lus10009388 locus=Lus10009388.g ID=Lus10009388.BGIv1.0 annot-version=v1.0 ATGATGTTGCATCTGATGAAGGAGATATCAGGAATCCCAACATCTCAGAAGAAAGAACCTTCTCAGATGGCTGCCTCGTCCGATGTGATGGGTGAATTGT CTAGCTCATGTACTGCTAGACTTGATAAAACATACAGTTTCCGTGCACTTTAG
AA sequence Show only first row Show all	>Lus10009388 pacid=23142631 polypeptide=Lus10009388 locus=Lus10009388.g ID=Lus10009388.BGIv1.0 annot-version=v1.0 MMLHLMKEISGIPTSQKKEPSQMAASSDVMGELSSSCTARLDKTYSFRAL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G35980			unknown protein		Lus10009388 [exp]	0	1
AT2G26730			Leucine-rich repeat protein ki...		Lus10001900 [exp]	1.0	0.9185
AT2G38290		AMT2;1, ATAMT2	AMMONIUM TRANSPORTER 2;1, ammo...		Lus10024833 [exp]	2.0	0.8741
AT2G44480		BGLU17	beta glucosidase 17 (.1.2)		Lus10037473 [exp]	2.6	0.8672
AT5G13460		IQD11	IQ-domain 11 (.1)		Lus10005315 [exp]	3.2	0.8962
AT3G17590		CHE1, BSH	BUSHY GROWTH, transcription re...		Lus10013697 [exp]	5.7	0.8314
AT1G60060			Serine/threonine-protein kinas...		Lus10024800 [exp]	12.1	0.8834
AT5G24550		BGLU32	beta glucosidase 32 (.1)		Lus10012868 [exp]	12.7	0.8721
AT1G01630			Sec14p-like phosphatidylinosit...		Lus10004684 [exp]	13.2	0.8734
AT5G35670		IQD33	IQ-domain 33 (.1)		Lus10000919 [exp]	13.3	0.8162
AT2G28630		KCS12	3-ketoacyl-CoA synthase 12 (.1...		Lus10004918 [exp]	13.7	0.8443

Compare expression of checked genes

Lus10009388 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.