Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G07370 95 / 8e-25 ATIPK2A, IPK2a inositol polyphosphate kinase 2 alpha (.1.2.3.4) AT5G61760 82 / 4e-20 ATIPK2BETA ARABIDOPSIS THALIANA INOSITOL POLYPHOSPHATE KINASE 2 BETA, inositol polyphosphate kinase 2 beta (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009385 [exp] 167 / 1e-52 AT5G61760 350 / 8e-122 ARABIDOPSIS THALIANA INOSITOL POLYPHOSPHATE KINASE 2 BETA, inositol polyphosphate kinase 2 beta (.1) Lus10020535 [exp] 158 / 3e-49 AT5G61760 354 / 6e-123 ARABIDOPSIS THALIANA INOSITOL POLYPHOSPHATE KINASE 2 BETA, inositol polyphosphate kinase 2 beta (.1) Lus10020534 [exp] 0 / 1 AT5G36930 414 / 1e-124 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G109500 [exp] 113 / 9e-32 AT5G61760 394 / 2e-138 ARABIDOPSIS THALIANA INOSITOL POLYPHOSPHATE KINASE 2 BETA, inositol polyphosphate kinase 2 beta (.1) Potri.012G111400 [exp] 106 / 5e-29 AT5G61760 404 / 1e-142 ARABIDOPSIS THALIANA INOSITOL POLYPHOSPHATE KINASE 2 BETA, inositol polyphosphate kinase 2 beta (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [flax] [poplar] PKinase PF03770 [flax] [poplar] IPK Inositol polyphosphate kinase
Representative CDS sequence Show only first row Show all	>Lus10009397 pacid=23142624 polypeptide=Lus10009397 locus=Lus10009397.g ID=Lus10009397.BGIv1.0 annot-version=v1.0 ATGGACATTACGATTGGTTCCAGGACGTGGTACCCCGAGGCTTCTCGAGCCTATATTGAGAAATGCATGAAGAAGGATACCGAATCCAGCAGTCCCTTGC TTGGGTTTCGGATATCCGGATTGCAGGTTTACGGTAACGACAAAGAATCATCGGAGGTGGTCTTGAAGCCTGAGAGGAAGCTTCTCCAGAATCTGAATGC TGGTGAAGTTAGGCTGGTGCTTAAACGGTTTGTTTCCTCCAACCCGATTGTTCGTTTGCAGCGGTCCTTAACGGTGGCTCGAATGGGATCTTGGCTCAGT TGCTGGAGCTGA
AA sequence Show only first row Show all	>Lus10009397 pacid=23142624 polypeptide=Lus10009397 locus=Lus10009397.g ID=Lus10009397.BGIv1.0 annot-version=v1.0 MDITIGSRTWYPEASRAYIEKCMKKDTESSSPLLGFRISGLQVYGNDKESSEVVLKPERKLLQNLNAGEVRLVLKRFVSSNPIVRLQRSLTVARMGSWLS CWS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G07370		ATIPK2A, IPK2a	inositol polyphosphate kinase ...		Lus10009397 [exp]	0	1
AT5G62440			Protein of unknown function (D...		Lus10023594 [exp]	1.4	0.8762
AT2G45140		PVA12	plant VAP homolog 12 (.1)		Lus10000032 [exp]	3.5	0.8482
AT1G31420		FEI1	FEI 1, Leucine-rich repeat pro...		Lus10034739 [exp]	4.2	0.8107
AT3G03450	GRAS	RGL2	RGA-like 2 (.1)		Lus10037758 [exp]	7.5	0.7870
AT1G06530		PMD2	peroxisomal and mitochondrial ...		Lus10020770 [exp]	8.2	0.7897
AT4G21390		B120	S-locus lectin protein kinase ...		Lus10020051 [exp]	12.2	0.7931
AT4G23290		CRK21	cysteine-rich RLK (RECEPTOR-li...		Lus10019599 [exp]	14.6	0.7327
AT5G58970		ATUCP2	uncoupling protein 2 (.1.2)		Lus10040709 [exp]	17.3	0.8269
AT5G61760		ATIPK2BETA	ARABIDOPSIS THALIANA INOSITOL ...		Lus10009385 [exp]	19.2	0.8082
AT5G37980			Zinc-binding dehydrogenase fam...		Lus10004380 [exp]	20.8	0.8273

Compare expression of checked genes

Lus10009397 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.