Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G29940 50 / 1e-08 ABCG31, PDR3, ATPDR3 ATP-binding cassette G31, pleiotropic drug resistance 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020550 [exp] 141 / 1e-40 AT2G29940 1962 / 0.0 ATP-binding cassette G31, pleiotropic drug resistance 3 (.1) Lus10018230 [exp] 78 / 3e-18 AT2G29940 2141 / 0.0 ATP-binding cassette G31, pleiotropic drug resistance 3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G251100 [exp] 60 / 7e-12 AT2G29940 2081 / 0.0 ATP-binding cassette G31, pleiotropic drug resistance 3 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10009398 pacid=23142616 polypeptide=Lus10009398 locus=Lus10009398.g ID=Lus10009398.BGIv1.0 annot-version=v1.0 ATGTCCGACATCGCTGATCTGGAAACGGTGCACCACGATTCAGACGACGAGAAGCTGAATATTTGGAAGGAGATCAGTGCTCTGCCGCCGGAGGAGCGGC GCCACTACTCCGTCCTCCGACGAACTCCTTCCGAGTTAATCGCGGGTGAGGATCGGATTCGGCTAGCGGAGAAGATCGACGTCAGGAAACTCGATCTCGC CGGTAGGAAGTTCGTGCTGAGGAAAGCTCTCGGTACGAACTCTCAGGATAACTCGAATCTCCTCGCCTGA
AA sequence Show only first row Show all	>Lus10009398 pacid=23142616 polypeptide=Lus10009398 locus=Lus10009398.g ID=Lus10009398.BGIv1.0 annot-version=v1.0 MSDIADLETVHHDSDDEKLNIWKEISALPPEERRHYSVLRRTPSELIAGEDRIRLAEKIDVRKLDLAGRKFVLRKALGTNSQDNSNLLA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G29940		ABCG31, PDR3, A...	ATP-binding cassette G31, plei...		Lus10009398 [exp]	0	1
AT2G34750			RNA polymerase I specific tran...		Lus10005693 [exp]	1.0	0.9237
AT2G43590			Chitinase family protein (.1)		Lus10024368 [exp]	4.7	0.8997
AT2G18250		ATCOAD	4-phosphopantetheine adenylylt...		Lus10014296 [exp]	6.6	0.9111
AT2G43590			Chitinase family protein (.1)		Lus10010861 [exp]	6.7	0.9084
AT3G10120			unknown protein		Lus10027167 [exp]	7.3	0.9180
AT5G49555			FAD/NAD(P)-binding oxidoreduct...		Lus10024010 [exp]	8.7	0.8917
AT3G48670		RDM12, IDN2	RNA-DIRECTED DNA METHYLATION 1...		Lus10002703 [exp]	10.6	0.9019
AT5G27600		LACS7, ATLACS7	long-chain acyl-CoA synthetase...		Lus10029918 [exp]	13.2	0.9162
AT4G21790		ATTOM1, TOM1	tobamovirus multiplication 1 (...		Lus10007663 [exp]	14.3	0.9069
AT3G23360			Protein phosphatase 2C family ...		Lus10011808 [exp]	14.5	0.8561

Compare expression of checked genes

Lus10009398 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.