Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G29940 113 / 1e-30 ABCG31, PDR3, ATPDR3 ATP-binding cassette G31, pleiotropic drug resistance 3 (.1) AT1G15210 105 / 1e-27 ABCG35, PDR7, ATPDR7 ATP-binding cassette G35, pleiotropic drug resistance 7 (.1) AT1G59870 103 / 3e-27 ATABCG36, ABCG36, PEN3, PDR8, ATPDR8 PENETRATION 3, ARABIDOPSIS PLEIOTROPIC DRUG RESISTANCE 8, Arabidopsis thaliana ATP-binding cassette G36, ATP-binding cassette G36, ABC-2 and Plant PDR ABC-type transporter family protein (.1) AT3G16340 99 / 2e-25 ABCG29, ATPDR1, PDR1, AtABCG29 ATP-binding cassette G29, pleiotropic drug resistance 1 (.1.2) AT1G15520 99 / 2e-25 ATABCG40, ABCG40, PDR12, ATPDR12 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) AT2G26910 92 / 5e-23 PEC1, ABCG32, PDR4, ATPDR4 PERMEABLE CUTICLE 1, ATP-binding cassette G32, pleiotropic drug resistance 4 (.1) AT3G30842 92 / 7e-23 ABCG38, PDR10, ATPDR10 ATP-binding cassette G38, pleiotropic drug resistance 10 (.1) AT3G53480 91 / 7e-23 PIS1, ABCG37, PDR9, ATPDR9 polar auxin transport inhibitor sensitive 1, ATP-binding cassette G37, pleiotropic drug resistance 9 (.1) AT1G66950 89 / 4e-22 ABCG39, PDR11, ATPDR11 ATP-binding cassette G39, pleiotropic drug resistance 11 (.1) AT2G36380 87 / 2e-21 ABCG34, PDR6, ATPDR6 ATP-binding cassette G34, pleiotropic drug resistance 6 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020550 [exp] 137 / 7e-39 AT2G29940 1962 / 0.0 ATP-binding cassette G31, pleiotropic drug resistance 3 (.1) Lus10018230 [exp] 130 / 2e-36 AT2G29940 2141 / 0.0 ATP-binding cassette G31, pleiotropic drug resistance 3 (.1) Lus10041668 [exp] 103 / 6e-27 AT1G15520 2128 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Lus10037562 [exp] 99 / 2e-25 AT1G59870 2178 / 0.0 PENETRATION 3, ARABIDOPSIS PLEIOTROPIC DRUG RESISTANCE 8, Arabidopsis thaliana ATP-binding cassette G36, ATP-binding cassette G36, ABC-2 and Plant PDR ABC-type transporter family protein (.1) Lus10014150 [exp] 99 / 2e-25 AT3G16340 2221 / 0.0 ATP-binding cassette G29, pleiotropic drug resistance 1 (.1.2) Lus10027727 [exp] 97 / 7e-25 AT1G66950 974 / 0.0 ATP-binding cassette G39, pleiotropic drug resistance 11 (.1) Lus10008090 [exp] 95 / 6e-24 AT1G15520 2045 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Lus10019453 [exp] 94 / 1e-23 AT2G26910 2354 / 0.0 PERMEABLE CUTICLE 1, ATP-binding cassette G32, pleiotropic drug resistance 4 (.1) Lus10008984 [exp] 93 / 2e-23 AT2G36380 2007 / 0.0 ATP-binding cassette G34, pleiotropic drug resistance 6 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G251100 [exp] 120 / 5e-33 AT2G29940 2081 / 0.0 ATP-binding cassette G31, pleiotropic drug resistance 3 (.1) Potri.003G049600 [exp] 99 / 2e-25 AT3G16340 2065 / 0.0 ATP-binding cassette G29, pleiotropic drug resistance 1 (.1.2) Potri.001G189500 [exp] 97 / 6e-25 AT1G59870 2113 / 0.0 PENETRATION 3, ARABIDOPSIS PLEIOTROPIC DRUG RESISTANCE 8, Arabidopsis thaliana ATP-binding cassette G36, ATP-binding cassette G36, ABC-2 and Plant PDR ABC-type transporter family protein (.1) Potri.006G248500 [exp] 96 / 1e-24 AT1G15520 2050 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Potri.008G024400 [exp] 95 / 3e-24 AT1G66950 2011 / 0.0 ATP-binding cassette G39, pleiotropic drug resistance 11 (.1) Potri.006G115000 [exp] 95 / 5e-24 AT1G66950 2148 / 0.0 ATP-binding cassette G39, pleiotropic drug resistance 11 (.1) Potri.018G032900 [exp] 95 / 5e-24 AT1G15520 2041 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Potri.001G175700 [exp] 93 / 2e-23 AT1G15520 2058 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Potri.003G183200 [exp] 92 / 3e-23 AT1G15520 2031 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Potri.001G049000 [exp] 92 / 3e-23 AT1G15520 1847 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10009399 pacid=23142598 polypeptide=Lus10009399 locus=Lus10009399.g ID=Lus10009399.BGIv1.0 annot-version=v1.0 ATGGAAGGAACCGTACTAATGGTTTTCCTCCACCCGCCGCCGAAGACGTTCAACCTCTTCAACCACCTCTTCCTACTGTCGGAAGGCCACTTGGTGTACT CCGGACCTAGATCCGAAGTCCTCGAGTTCTTCGAGTCCTTAGGGTTTCGCTTGTCCCCGCAAAAGGGTGCCGCGTACTTCCTCCAAGATGTTACATTGAA AAAGGACCAAGCACAATACTGGGTGGACGACATAAGATCGTACTTGTTTTGTCTGTGCCAGAGATTGCAAAGGCGTTCACAGCCTCCCGGTTTTGTACAC CCCTAG
AA sequence Show only first row Show all	>Lus10009399 pacid=23142598 polypeptide=Lus10009399 locus=Lus10009399.g ID=Lus10009399.BGIv1.0 annot-version=v1.0 MEGTVLMVFLHPPPKTFNLFNHLFLLSEGHLVYSGPRSEVLEFFESLGFRLSPQKGAAYFLQDVTLKKDQAQYWVDDIRSYLFCLCQRLQRRSQPPGFVH P

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G29940		ABCG31, PDR3, A...	ATP-binding cassette G31, plei...		Lus10009399 [exp]	0	1
AT5G60010			ferric reductase-like transmem...		Lus10019390 [exp]	4.0	0.9823
					Lus10027066 [exp]	5.7	0.9823
					Lus10040397 [exp]	6.9	0.9823
					Lus10006918 [exp]	8.0	0.9823
					Lus10007508 [exp]	8.9	0.9823
AT4G33985			Protein of unknown function (D...		Lus10027898 [exp]	9.8	0.9180
AT1G04670			unknown protein		Lus10004041 [exp]	9.8	0.9823
AT3G53690			RING/U-box superfamily protein...		Lus10042610 [exp]	10.6	0.9823
AT1G22440			Zinc-binding alcohol dehydroge...		Lus10009516 [exp]	11.3	0.9823
AT5G14180		MPL1	Myzus persicae-induced lipase ...		Lus10015158 [exp]	12.0	0.9823

Compare expression of checked genes

Lus10009399 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.