Lus10009402 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G27810 47 / 6e-07 ATNAT12 ARABIDOPSIS NUCLEOBASE-ASCORBATE TRANSPORTER 12, nucleobase-ascorbate transporter 12 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020551 85 / 3e-20 AT2G27810 891 / 0.0 ARABIDOPSIS NUCLEOBASE-ASCORBATE TRANSPORTER 12, nucleobase-ascorbate transporter 12 (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G148600 69 / 1e-14 AT2G27810 900 / 0.0 ARABIDOPSIS NUCLEOBASE-ASCORBATE TRANSPORTER 12, nucleobase-ascorbate transporter 12 (.1.2.3)
Potri.004G187900 68 / 2e-14 AT2G27810 880 / 0.0 ARABIDOPSIS NUCLEOBASE-ASCORBATE TRANSPORTER 12, nucleobase-ascorbate transporter 12 (.1.2.3)
PFAM info
Representative CDS sequence
>Lus10009402 pacid=23142627 polypeptide=Lus10009402 locus=Lus10009402.g ID=Lus10009402.BGIv1.0 annot-version=v1.0
ATGTCCGGCACCGACCCGAAGACCCGGCCCAAACCTGGCCCGTTCCTGCCTACTCCGGAGTCCTCACCATTGCCGCCTGCCTCCTGGGCTAAGAAGACCG
GCTTCCGTCCCAGCTTCTCCGGCCAGGCCACATCCCGCGACTCCCGGCCGATATCTCCCCCGCCAAAAAACGGCGGCTGCGACTACGACGGTGAATGGGA
GGGAGGCGGTGCCGGTGAAGAGGAGGAGGGATTCGGATGGTGGGAGTGGTGGAAAGAGGAAGGAGCCGTCGTCGACGACGTCGGTTCACGGGGCGGTGAA
TGGACAAGGGAATTCGGAAGCTACGAGAAGAGCGACGAGGAATGA
AA sequence
>Lus10009402 pacid=23142627 polypeptide=Lus10009402 locus=Lus10009402.g ID=Lus10009402.BGIv1.0 annot-version=v1.0
MSGTDPKTRPKPGPFLPTPESSPLPPASWAKKTGFRPSFSGQATSRDSRPISPPPKNGGCDYDGEWEGGGAGEEEEGFGWWEWWKEEGAVVDDVGSRGGE
WTREFGSYEKSDEE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G27810 ATNAT12 ARABIDOPSIS NUCLEOBASE-ASCORBA... Lus10009402 0 1
AT2G27810 ATNAT12 ARABIDOPSIS NUCLEOBASE-ASCORBA... Lus10009401 1.0 0.9384
AT3G42860 zinc knuckle (CCHC-type) famil... Lus10012985 2.0 0.9341
AT2G01210 Leucine-rich repeat protein ki... Lus10043480 2.4 0.9034
AT2G42920 Pentatricopeptide repeat (PPR-... Lus10007341 2.8 0.9042
AT5G61960 AML1 MEI2-like protein 1 (.1.2) Lus10032537 3.5 0.9193
AT2G34680 AIR9 AUXIN-INDUCED IN ROOT CULTURES... Lus10038534 5.9 0.9042
AT1G43770 RING/FYVE/PHD zinc finger supe... Lus10028603 10.5 0.8633
AT4G34980 SLP2 subtilisin-like serine proteas... Lus10034495 11.2 0.8932
AT3G18290 BTS, EMB2454 embryo defective 2454, BRUTUS,... Lus10034346 14.3 0.8879
AT2G33700 Protein phosphatase 2C family ... Lus10012244 15.9 0.8599

Lus10009402 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.