Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G22580 122 / 2e-37 Stress responsive A/B Barrel Domain (.1) AT3G17210 71 / 5e-17 ATHS1 A. THALIANA HEAT STABLE PROTEIN 1, heat stable protein 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020555 [exp] 202 / 2e-69 AT5G22580 133 / 9e-42 Stress responsive A/B Barrel Domain (.1) Lus10037823 [exp] 62 / 1e-13 AT3G17210 170 / 1e-56 A. THALIANA HEAT STABLE PROTEIN 1, heat stable protein 1 (.1) Lus10000094 [exp] 54 / 1e-10 AT3G17210 162 / 6e-53 A. THALIANA HEAT STABLE PROTEIN 1, heat stable protein 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G148100 [exp] 140 / 8e-45 AT5G22580 118 / 7e-36 Stress responsive A/B Barrel Domain (.1) Potri.004G187500 [exp] 137 / 2e-43 AT5G22580 134 / 3e-42 Stress responsive A/B Barrel Domain (.1) Potri.010G037500 [exp] 73 / 5e-18 AT3G17210 170 / 2e-56 A. THALIANA HEAT STABLE PROTEIN 1, heat stable protein 1 (.1) Potri.010G037200 [exp] 71 / 2e-16 AT3G17210 169 / 4e-55 A. THALIANA HEAT STABLE PROTEIN 1, heat stable protein 1 (.1) Potri.010G150900 [exp] 65 / 7e-15 AT3G17210 146 / 8e-47 A. THALIANA HEAT STABLE PROTEIN 1, heat stable protein 1 (.1) Potri.010G151000 [exp] 63 / 3e-14 AT3G17210 134 / 3e-42 A. THALIANA HEAT STABLE PROTEIN 1, heat stable protein 1 (.1) Potri.010G150800 [exp] 43 / 2e-06 AT3G17210 92 / 1e-25 A. THALIANA HEAT STABLE PROTEIN 1, heat stable protein 1 (.1) Potri.010G150500 [exp] 43 / 2e-06 AT3G17210 100 / 5e-29 A. THALIANA HEAT STABLE PROTEIN 1, heat stable protein 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0032 [flax] [poplar] Dim_A_B_barrel PF07876 [flax] [poplar] Dabb Stress responsive A/B Barrel Domain
Representative CDS sequence Show only first row Show all	>Lus10009407 pacid=23142607 polypeptide=Lus10009407 locus=Lus10009407.g ID=Lus10009407.BGIv1.0 annot-version=v1.0 ATGGCTGCTCCAGAGTTCAAGCACTTGGCAATCATCAAAGAAGGTGTTGTGGTGGATGAGATGATCAAAGGGATGGAGAAGCTTGTCTCTGAGATCTCTC TCATCAAGTCCTTGGAATGGGGACAGGATCTGGAAGGGCATGAGATGCTGACACAAGGGTTCACACATGCATTCACACTGACATTCAACAGCAAGGAAGA CTACATTGCTTATGATAATCATCCAACCCACCTTGAGTATGCAGCTGCGTTCTCTGCAAGTATTGAGAAATTTGTGGTGCTCAACTACCCTACTGTTCTT CTCAGCCAGACCTAA
AA sequence Show only first row Show all	>Lus10009407 pacid=23142607 polypeptide=Lus10009407 locus=Lus10009407.g ID=Lus10009407.BGIv1.0 annot-version=v1.0 MAAPEFKHLAIIKEGVVVDEMIKGMEKLVSEISLIKSLEWGQDLEGHEMLTQGFTHAFTLTFNSKEDYIAYDNHPTHLEYAAAFSASIEKFVVLNYPTVL LSQT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G22580			Stress responsive A/B Barrel D...		Lus10009407 [exp]	0	1
AT4G19510			Disease resistance protein (TI...		Lus10008209 [exp]	2.0	0.9489
AT5G14090			unknown protein		Lus10037042 [exp]	2.4	0.9401
AT5G59320		LTP3	lipid transfer protein 3 (.1)		Lus10024201 [exp]	3.0	0.9379
AT3G48670		RDM12, IDN2	RNA-DIRECTED DNA METHYLATION 1...		Lus10002305 [exp]	3.7	0.9145
AT1G68800	TCP	TCP12, BRC2, TC...	BRANCHED 2, TCP domain protein...		Lus10042962 [exp]	4.2	0.9098
AT1G20640		NLP4	Plant regulator RWP-RK family ...		Lus10003318 [exp]	5.0	0.8790
					Lus10035810 [exp]	5.5	0.9022
AT5G10140	MADS	FLF, AGL25, FLC	FLOWERING LOCUS F, FLOWERING L...		Lus10037039 [exp]	7.0	0.8569
					Lus10005309 [exp]	7.7	0.8751
AT1G69550			disease resistance protein (TI...		Lus10005376 [exp]	7.7	0.8923

Compare expression of checked genes

Lus10009407 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.