Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G31750 78 / 1e-18 UGT74D1 UDP-glucosyl transferase 74D1 (.1) AT1G05675 71 / 4e-16 UDP-Glycosyltransferase superfamily protein (.1) AT1G05680 69 / 2e-15 UGT74E2 Uridine diphosphate glycosyltransferase 74E2 (.1) AT2G43820 52 / 2e-09 SGT1, ATSAGT1, GT, UGT74F2 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1) AT2G43840 51 / 3e-09 UGT74F1 UDP-glycosyltransferase 74 F1 (.1.2) AT2G31790 49 / 2e-08 UDP-Glycosyltransferase superfamily protein (.1) AT1G24100 48 / 3e-08 UGT74B1 UDP-glucosyl transferase 74B1 (.1) AT3G16520 46 / 2e-07 UGT88A1 UDP-glucosyl transferase 88A1 (.1.2.3) AT3G02100 45 / 3e-07 UDP-Glycosyltransferase superfamily protein (.1) AT5G17050 44 / 9e-07 UGT78D2 UDP-glucosyl transferase 78D2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009412 [exp] 108 / 1e-29 AT2G43820 474 / 1e-165 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1) Lus10020556 [exp] 101 / 3e-27 AT2G43820 472 / 1e-164 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1) Lus10009414 [exp] 67 / 3e-15 AT2G27285 110 / 7e-29 Coiled-coil domain-containing protein 55 (DUF2040) (.1) Lus10024834 [exp] 67 / 1e-14 AT2G43820 290 / 7e-93 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1) Lus10008742 [exp] 67 / 1e-14 AT2G43840 478 / 6e-167 UDP-glycosyltransferase 74 F1 (.1.2) Lus10020559 [exp] 66 / 1e-14 AT2G43820 436 / 3e-150 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1) Lus10024486 [exp] 65 / 5e-14 AT1G05680 389 / 4e-132 Uridine diphosphate glycosyltransferase 74E2 (.1) Lus10014148 [exp] 61 / 2e-12 AT2G43840 407 / 2e-139 UDP-glycosyltransferase 74 F1 (.1.2) Lus10006351 [exp] 59 / 3e-12 AT1G05680 315 / 9e-106 Uridine diphosphate glycosyltransferase 74E2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G117200 [exp] 75 / 1e-17 AT2G43840 461 / 1e-160 UDP-glycosyltransferase 74 F1 (.1.2) Potri.007G141700 [exp] 66 / 2e-15 AT1G05680 237 / 4e-77 Uridine diphosphate glycosyltransferase 74E2 (.1) Potri.017G032300 [exp] 66 / 1e-14 AT1G05675 465 / 6e-162 UDP-Glycosyltransferase superfamily protein (.1) Potri.017G032700 [exp] 66 / 1e-14 AT1G05680 444 / 6e-154 Uridine diphosphate glycosyltransferase 74E2 (.1) Potri.017G032733 [exp] 66 / 1e-14 AT1G05680 444 / 6e-154 Uridine diphosphate glycosyltransferase 74E2 (.1) Potri.017G032500 [exp] 66 / 2e-14 AT1G05680 446 / 1e-154 Uridine diphosphate glycosyltransferase 74E2 (.1) Potri.007G140500 [exp] 65 / 4e-14 AT2G43840 463 / 3e-161 UDP-glycosyltransferase 74 F1 (.1.2) Potri.001G389200 [exp] 64 / 7e-14 AT1G05680 494 / 2e-173 Uridine diphosphate glycosyltransferase 74E2 (.1) Potri.007G140300 [exp] 63 / 2e-13 AT1G05680 457 / 4e-159 Uridine diphosphate glycosyltransferase 74E2 (.1) Potri.007G141900 [exp] 61 / 4e-13 AT1G05675 271 / 2e-89 UDP-Glycosyltransferase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10009409 pacid=23142619 polypeptide=Lus10009409 locus=Lus10009409.g ID=Lus10009409.BGIv1.0 annot-version=v1.0 ATGATCGAGCTAGCTTCGGGCCTCAAGCGAACGAACCACTACATCATATGGGTCATCCACGATACCGAGCTAGTGAAGCTCCCAACCAATCTCGTCAGTG ACTTGGAGGACAAGGCACTGGTTGTGAACTGTGCCCCACAGGTCCAGTTCCTGTCCAGCAAGGCCGTTGGTTGCTTTTTCACACGCTCTAGGTGA
AA sequence Show only first row Show all	>Lus10009409 pacid=23142619 polypeptide=Lus10009409 locus=Lus10009409.g ID=Lus10009409.BGIv1.0 annot-version=v1.0 MIELASGLKRTNHYIIWVIHDTELVKLPTNLVSDLEDKALVVNCAPQVQFLSSKAVGCFFTRSR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G31750		UGT74D1	UDP-glucosyl transferase 74D1 ...		Lus10009409 [exp]	0	1
					Lus10002332 [exp]	3.0	1.0000
AT1G02335		GL22	germin-like protein subfamily ...		Lus10004856 [exp]	4.2	1.0000
AT2G43870			Pectin lyase-like superfamily ...		Lus10011417 [exp]	5.2	1.0000
AT3G05950			RmlC-like cupins superfamily p...		Lus10023351 [exp]	6.0	1.0000
AT3G53710		AGD6	ARF-GAP domain 6 (.1.2)		Lus10012991 [exp]	6.7	1.0000
AT3G19270		CYP707A4	"cytochrome P450, family 707, ...		Lus10014056 [exp]	7.3	1.0000
AT1G17930			Aminotransferase-like, plant m...		Lus10031075 [exp]	7.9	1.0000
AT5G23960		ATTPS21	terpene synthase 21 (.1.2)		Lus10033189 [exp]	8.5	1.0000
AT2G28630		KCS12	3-ketoacyl-CoA synthase 12 (.1...		Lus10033628 [exp]	9.0	1.0000
AT4G35500			Protein kinase superfamily pro...		Lus10035984 [exp]	9.9	0.9586

Compare expression of checked genes

Lus10009409 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.