Lus10009415 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G18010 93 / 3e-23 Major facilitator superfamily protein (.1)
AT1G18000 93 / 3e-23 Major facilitator superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019528 103 / 5e-27 AT1G18010 659 / 0.0 Major facilitator superfamily protein (.1)
Lus10043371 102 / 1e-26 AT1G18010 657 / 0.0 Major facilitator superfamily protein (.1)
Lus10006288 88 / 4e-21 AT1G18010 649 / 0.0 Major facilitator superfamily protein (.1)
Lus10019527 83 / 2e-19 AT1G18010 578 / 0.0 Major facilitator superfamily protein (.1)
Lus10009413 44 / 8e-06 AT1G18010 152 / 2e-47 Major facilitator superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G005100 96 / 3e-24 AT1G18010 630 / 0.0 Major facilitator superfamily protein (.1)
Potri.012G011000 72 / 1e-15 AT1G18010 422 / 5e-146 Major facilitator superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10009415 pacid=23142628 polypeptide=Lus10009415 locus=Lus10009415.g ID=Lus10009415.BGIv1.0 annot-version=v1.0
ATGAACATGGAAAACGGCACCTGCACCGGCGGCCACCAGGAGTCGGCTCCTGCCGCCACCACCGTGGCGGTACCCGATAATTCTCGTTGGAGGCACAACT
CGCCGTTGACCCAAGTCGTCCTAATCGGACTAGTATGCTTCTGTTGCCCGGGGATGTTTCGAGCACTCACCGGGCTGGGCGGCGGAGGACAGGTGGACCC
CACCGCCGCCAACAAGGCCAATACAGCCGTGTACGCTACTTTTGCAGCGTTTAGCTTCGCCGGCGGGGGGCCGCGCACGCGGCGTGGGCCCAGGCACACT
CCTCTACAATGTCCTGGGCCCACGCCTCATGCTCCCTGCAGGGTGTGTTACCTACGCGCTGTACGCGTGGTCTTTCCTCTACTATAA
AA sequence
>Lus10009415 pacid=23142628 polypeptide=Lus10009415 locus=Lus10009415.g ID=Lus10009415.BGIv1.0 annot-version=v1.0
MNMENGTCTGGHQESAPAATTVAVPDNSRWRHNSPLTQVVLIGLVCFCCPGMFRALTGLGGGGQVDPTAANKANTAVYATFAAFSFAGGGPRTRRGPRHT
PLQCPGPTPHAPCRVCYLRAVRVVFPLL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G18010 Major facilitator superfamily ... Lus10009415 0 1
AT2G29090 CYP707A2 "cytochrome P450, family 707, ... Lus10016515 15.2 0.7432
AT1G13890 ATSNAP30, SNAP3... soluble N-ethylmaleimide-sensi... Lus10036893 20.5 0.6631
AT1G14040 EXS (ERD1/XPR1/SYG1) family pr... Lus10026623 42.0 0.6722
AT3G02230 ATRGP1, RGP1 ARABIDOPSIS THALIANA REVERSIBL... Lus10034376 49.0 0.6579
AT1G52560 HSP20-like chaperones superfam... Lus10023653 54.9 0.6678
AT3G02125 unknown protein Lus10013196 61.6 0.6592
AT3G07610 IBM1 increase in bonsai methylation... Lus10004549 71.1 0.6521
Lus10005955 81.2 0.6442
AT1G71120 GLIP6 GDSL-motif lipase/hydrolase 6 ... Lus10034635 91.8 0.6425
AT2G40340 AP2_ERF AtERF48, DREB2C Integrase-type DNA-binding sup... Lus10023633 92.9 0.6214

Lus10009415 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.